ClCG04G005840 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: five_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.CCAAAAACCGACCATGAAAGTGAATCGCATGGTGTTGCTGCTGCTTCTTCTTGCTGTGTTCGATTTGGGGTTTTCCGTTGAAGACCCATTTATCAGGATGAAACTAGGAGGCGTTTGCGATTACATTGGCGCTCAGAACAGCGTTGAAATCGACTCTCTCGCTCGTTTTGCAGCTCAAGAACGCAACAAGAAAGAGGTCTTTTCCTTTGTTTTCTTTACTTTTACTGCTCCTCACTCCCCTTTTCCTTCTCTGGGTGTCGATTAATTTCTGGGTTCGTTTCACTCTCTGGTTTTCTTTCTTATTGCCCTCGGAATCGAGTCAATTCCTCACTTCATTCGTTACTGTTCATGGTCCGTTTTAATTTGTTTAACCACCAATTCTGAGTTCTTGTTTCTTTGGTGTAGAATTGTCTTTGCTAAAGAACAGGTAGTTGCTGGTAAATTGTATCATCTTAAATTGGAAGCCATTAATGGTGGTAAGAAGAAGGTCTATGAAGCCAAAGTCTGGGTAAAGCCATGGATGAACTTCAAACAGTTGCAAGAATTCAAACTACGGCCATGA CCAAAAACCGACCATGAAAGTGAATCGCATGGTGTTGCTGCTGCTTCTTCTTGCTGTGTTCGATTTGGGGTTTTCCGTTGAAGACCCATTTATCAGGATGAAACTAGGAGGCGTTTGCGATTACATTGGCGCTCAGAACAGCGTTGAAATCGACTCTCTCGCTCGTTTTGCAGCTCAAGAACGCAACAAGAAAGAGGTAGTTGCTGGTAAATTGTATCATCTTAAATTGGAAGCCATTAATGGTGGTAAGAAGAAGGTCTATGAAGCCAAAGTCTGGGTAAAGCCATGGATGAACTTCAAACAGTTGCAAGAATTCAAACTACGGCCATGA ATGAAAGTGAATCGCATGGTGTTGCTGCTGCTTCTTCTTGCTGTGTTCGATTTGGGGTTTTCCGTTGAAGACCCATTTATCAGGATGAAACTAGGAGGCGTTTGCGATTACATTGGCGCTCAGAACAGCGTTGAAATCGACTCTCTCGCTCGTTTTGCAGCTCAAGAACGCAACAAGAAAGAGGTAGTTGCTGGTAAATTGTATCATCTTAAATTGGAAGCCATTAATGGTGGTAAGAAGAAGGTCTATGAAGCCAAAGTCTGGGTAAAGCCATGGATGAACTTCAAACAGTTGCAAGAATTCAAACTACGGCCATGA MKVNRMVLLLLLLAVFDLGFSVEDPFIRMKLGGVCDYIGAQNSVEIDSLARFAAQERNKKEVVAGKLYHLKLEAINGGKKKVYEAKVWVKPWMNFKQLQEFKLRP
BLAST of ClCG04G005840 vs. Swiss-Prot
Match: CYT6_ARATH (Cysteine proteinase inhibitor 6 OS=Arabidopsis thaliana GN=CYS6 PE=1 SV=2) HSP 1 Score: 99.4 bits (246), Expect = 2.5e-20 Identity = 56/110 (50.91%), Postives = 66/110 (60.00%), Query Frame = 1
BLAST of ClCG04G005840 vs. Swiss-Prot
Match: CYTI_VIGUN (Cysteine proteinase inhibitor OS=Vigna unguiculata PE=1 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 1.3e-19 Identity = 51/87 (58.62%), Postives = 58/87 (66.67%), Query Frame = 1
BLAST of ClCG04G005840 vs. Swiss-Prot
Match: CYT3_ARATH (Cysteine proteinase inhibitor 3 OS=Arabidopsis thaliana GN=CYS3 PE=2 SV=2) HSP 1 Score: 96.7 bits (239), Expect = 1.6e-19 Identity = 53/89 (59.55%), Postives = 57/89 (64.04%), Query Frame = 1
BLAST of ClCG04G005840 vs. Swiss-Prot
Match: CYT12_ORYSJ (Cysteine proteinase inhibitor 12 OS=Oryza sativa subsp. japonica GN=Os01g0270100 PE=2 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 4.8e-19 Identity = 56/115 (48.70%), Postives = 66/115 (57.39%), Query Frame = 1
BLAST of ClCG04G005840 vs. Swiss-Prot
Match: CYT7_ARATH (Cysteine proteinase inhibitor 7 OS=Arabidopsis thaliana GN=CYS7 PE=2 SV=2) HSP 1 Score: 94.7 bits (234), Expect = 6.2e-19 Identity = 52/95 (54.74%), Postives = 57/95 (60.00%), Query Frame = 1
BLAST of ClCG04G005840 vs. TrEMBL
Match: A0FK05_POPTO (Cysteine proteinase inhibitor OS=Populus tomentosa PE=2 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 8.2e-26 Identity = 67/111 (60.36%), Postives = 75/111 (67.57%), Query Frame = 1
BLAST of ClCG04G005840 vs. TrEMBL
Match: A0FK03_POPTO (Cysteine proteinase inhibitor OS=Populus tomentosa PE=3 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 8.2e-26 Identity = 67/111 (60.36%), Postives = 75/111 (67.57%), Query Frame = 1
BLAST of ClCG04G005840 vs. TrEMBL
Match: A9PCX4_POPTR (Cysteine proteinase inhibitor OS=Populus trichocarpa PE=2 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 1.8e-25 Identity = 66/111 (59.46%), Postives = 75/111 (67.57%), Query Frame = 1
BLAST of ClCG04G005840 vs. TrEMBL
Match: U5FQ48_POPTR (Cysteine proteinase inhibitor OS=Populus trichocarpa GN=POPTR_0016s03070g PE=3 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 1.8e-25 Identity = 66/111 (59.46%), Postives = 75/111 (67.57%), Query Frame = 1
BLAST of ClCG04G005840 vs. TrEMBL
Match: V4UVL8_9ROSI (Cysteine proteinase inhibitor OS=Citrus clementina GN=CICLE_v10012693mg PE=3 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 5.3e-25 Identity = 64/112 (57.14%), Postives = 76/112 (67.86%), Query Frame = 1
BLAST of ClCG04G005840 vs. TAIR10
Match: AT3G12490.2 (AT3G12490.2 cystatin B) HSP 1 Score: 99.4 bits (246), Expect = 1.4e-21 Identity = 56/110 (50.91%), Postives = 66/110 (60.00%), Query Frame = 1
BLAST of ClCG04G005840 vs. TAIR10
Match: AT2G40880.1 (AT2G40880.1 cystatin A) HSP 1 Score: 96.7 bits (239), Expect = 9.2e-21 Identity = 53/89 (59.55%), Postives = 57/89 (64.04%), Query Frame = 1
BLAST of ClCG04G005840 vs. TAIR10
Match: AT5G05110.1 (AT5G05110.1 Cystatin/monellin family protein) HSP 1 Score: 94.7 bits (234), Expect = 3.5e-20 Identity = 52/95 (54.74%), Postives = 57/95 (60.00%), Query Frame = 1
BLAST of ClCG04G005840 vs. TAIR10
Match: AT5G12140.1 (AT5G12140.1 cystatin-1) HSP 1 Score: 66.6 bits (161), Expect = 1.0e-11 Identity = 37/86 (43.02%), Postives = 45/86 (52.33%), Query Frame = 1
BLAST of ClCG04G005840 vs. NCBI nr
Match: gi|659111458|ref|XP_008455746.1| (PREDICTED: cysteine proteinase inhibitor A [Cucumis melo]) HSP 1 Score: 163.7 bits (413), Expect = 1.7e-37 Identity = 87/120 (72.50%), Postives = 93/120 (77.50%), Query Frame = 1
BLAST of ClCG04G005840 vs. NCBI nr
Match: gi|743896193|ref|XP_011041371.1| (PREDICTED: cysteine proteinase inhibitor 6-like [Populus euphratica]) HSP 1 Score: 126.3 bits (316), Expect = 3.1e-26 Identity = 68/111 (61.26%), Postives = 76/111 (68.47%), Query Frame = 1
BLAST of ClCG04G005840 vs. NCBI nr
Match: gi|116734393|gb|ABK20185.1| (cysteine protease inhibitor [Populus tomentosa]) HSP 1 Score: 124.4 bits (311), Expect = 1.2e-25 Identity = 67/111 (60.36%), Postives = 75/111 (67.57%), Query Frame = 1
BLAST of ClCG04G005840 vs. NCBI nr
Match: gi|116734397|gb|ABK20187.1| (cysteine protease inhibitor [Populus tomentosa]) HSP 1 Score: 124.4 bits (311), Expect = 1.2e-25 Identity = 67/111 (60.36%), Postives = 75/111 (67.57%), Query Frame = 1
BLAST of ClCG04G005840 vs. NCBI nr
Match: gi|225440171|ref|XP_002283400.1| (PREDICTED: cysteine proteinase inhibitor 12-like [Vitis vinifera]) HSP 1 Score: 123.6 bits (309), Expect = 2.0e-25 Identity = 70/123 (56.91%), Postives = 84/123 (68.29%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|