ClCG02G001340 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTTCATCAACAAGAGCTTTGGTCGTAGCAGCTACCGTCGGCGTCGTGGAGGCTCTCAAGGATCAAGGAATCTGCCGGTGGAATCATGTCTTAAGATCCGCCCATCACTACGCCAGAAACCATGTCCGGTCTATTTCTCAGGCCAAGAAGCTTTCCTCCGCCGTGCCTTCCGCCAACCACCTCCAACAGTCCGAGGAATCTCTGAGAACGGTGATGTACCTTAGCTGTTGGGGTCCTAATAACTGA ATGAGTTCATCAACAAGAGCTTTGGTCGTAGCAGCTACCGTCGGCGTCGTGGAGGCTCTCAAGGATCAAGGAATCTGCCGGTGGAATCATGTCTTAAGATCCGCCCATCACTACGCCAGAAACCATGTCCGGTCTATTTCTCAGGCCAAGAAGCTTTCCTCCGCCGTGCCTTCCGCCAACCACCTCCAACAGTCCGAGGAATCTCTGAGAACGGTGATGTACCTTAGCTGTTGGGGTCCTAATAACTGA ATGAGTTCATCAACAAGAGCTTTGGTCGTAGCAGCTACCGTCGGCGTCGTGGAGGCTCTCAAGGATCAAGGAATCTGCCGGTGGAATCATGTCTTAAGATCCGCCCATCACTACGCCAGAAACCATGTCCGGTCTATTTCTCAGGCCAAGAAGCTTTCCTCCGCCGTGCCTTCCGCCAACCACCTCCAACAGTCCGAGGAATCTCTGAGAACGGTGATGTACCTTAGCTGTTGGGGTCCTAATAACTGA MSSSTRALVVAATVGVVEALKDQGICRWNHVLRSAHHYARNHVRSISQAKKLSSAVPSANHLQQSEESLRTVMYLSCWGPNN
BLAST of ClCG02G001340 vs. TrEMBL
Match: A0A0A0K6Y8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G046640 PE=4 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 3.6e-37 Identity = 79/82 (96.34%), Postives = 80/82 (97.56%), Query Frame = 1
BLAST of ClCG02G001340 vs. TrEMBL
Match: A0A0A0K5N2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G046650 PE=4 SV=1) HSP 1 Score: 154.1 bits (388), Expect = 7.5e-35 Identity = 75/82 (91.46%), Postives = 77/82 (93.90%), Query Frame = 1
BLAST of ClCG02G001340 vs. TrEMBL
Match: A0A0A0K3P5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G046670 PE=4 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 7.1e-25 Identity = 62/85 (72.94%), Postives = 67/85 (78.82%), Query Frame = 1
BLAST of ClCG02G001340 vs. TrEMBL
Match: I3SKC5_LOTJA (Uncharacterized protein OS=Lotus japonicus PE=2 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 1.6e-24 Identity = 60/92 (65.22%), Postives = 72/92 (78.26%), Query Frame = 1
BLAST of ClCG02G001340 vs. TrEMBL
Match: A0A0B2S8V4_GLYSO (Uncharacterized protein OS=Glycine soja GN=glysoja_017207 PE=4 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 1.3e-23 Identity = 60/86 (69.77%), Postives = 66/86 (76.74%), Query Frame = 1
BLAST of ClCG02G001340 vs. TAIR10
Match: AT4G10265.1 (AT4G10265.1 Wound-responsive family protein) HSP 1 Score: 109.8 bits (273), Expect = 8.2e-25 Identity = 53/83 (63.86%), Postives = 69/83 (83.13%), Query Frame = 1
BLAST of ClCG02G001340 vs. TAIR10
Match: AT4G10270.1 (AT4G10270.1 Wound-responsive family protein) HSP 1 Score: 99.8 bits (247), Expect = 8.5e-22 Identity = 50/90 (55.56%), Postives = 65/90 (72.22%), Query Frame = 1
BLAST of ClCG02G001340 vs. TAIR10
Match: AT4G33560.1 (AT4G33560.1 Wound-responsive family protein) HSP 1 Score: 48.9 bits (115), Expect = 1.7e-06 Identity = 29/80 (36.25%), Postives = 41/80 (51.25%), Query Frame = 1
BLAST of ClCG02G001340 vs. NCBI nr
Match: gi|449438060|ref|XP_004136808.1| (PREDICTED: uncharacterized protein LOC101223015 [Cucumis sativus]) HSP 1 Score: 161.8 bits (408), Expect = 5.2e-37 Identity = 79/82 (96.34%), Postives = 80/82 (97.56%), Query Frame = 1
BLAST of ClCG02G001340 vs. NCBI nr
Match: gi|659110685|ref|XP_008455358.1| (PREDICTED: uncharacterized protein LOC103495544 [Cucumis melo]) HSP 1 Score: 156.4 bits (394), Expect = 2.2e-35 Identity = 76/82 (92.68%), Postives = 78/82 (95.12%), Query Frame = 1
BLAST of ClCG02G001340 vs. NCBI nr
Match: gi|449438058|ref|XP_004136807.1| (PREDICTED: uncharacterized protein LOC101222779 [Cucumis sativus]) HSP 1 Score: 154.1 bits (388), Expect = 1.1e-34 Identity = 75/82 (91.46%), Postives = 77/82 (93.90%), Query Frame = 1
BLAST of ClCG02G001340 vs. NCBI nr
Match: gi|659110681|ref|XP_008455355.1| (PREDICTED: uncharacterized protein LOC103495542 [Cucumis melo]) HSP 1 Score: 123.6 bits (309), Expect = 1.6e-25 Identity = 63/85 (74.12%), Postives = 69/85 (81.18%), Query Frame = 1
BLAST of ClCG02G001340 vs. NCBI nr
Match: gi|659110683|ref|XP_008455356.1| (PREDICTED: uncharacterized protein LOC103495543 [Cucumis melo]) HSP 1 Score: 123.2 bits (308), Expect = 2.0e-25 Identity = 64/85 (75.29%), Postives = 71/85 (83.53%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |