ClCG01G020860 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGAGGGCTAAGTTCTTTCCATCTGATGATTCGGGATATGATGTCCCAGGTAAGTATTATTTAATAGTTATCAATCTCTTTTTAATACTTCGACATGCTAACATGAAATTTTATTGCAGTTTGTGCTACTTCTTGTTGGCAAGCCCCTGAACTACGTCTGGGTGGACGACAAACATGCGTCGCGGATTTGTTTAGCTTGGGGTGCATCCTCTTTTATTGCATTACAGGGGGCAAACATCCATTTTGTGAGGATCAATTTGAGCGTGATGATAGGATTGTGATCAACATGTTCTTGTTGCATAAGCTCCCAGAAGCTTCAGATTTGATTTCTCAATTATTAGATCATGACCCTGAATTGAGATAA ATGGGGAGGGCTAAGTTCTTTCCATCTGATGATTCGGGATATGATGTCCCAGTTTGTGCTACTTCTTGTTGGCAAGCCCCTGAACTACGTCTGGGTGGACGACAAACATGCGTCGCGGATTTGTTTAGCTTGGGGTGCATCCTCTTTTATTGCATTACAGGGGGCAAACATCCATTTTGTGAGGATCAATTTGAGCGTGATGATAGGATTGTGATCAACATGTTCTTGTTGCATAAGCTCCCAGAAGCTTCAGATTTGATTTCTCAATTATTAGATCATGACCCTGAATTGAGATAA ATGGGGAGGGCTAAGTTCTTTCCATCTGATGATTCGGGATATGATGTCCCAGTTTGTGCTACTTCTTGTTGGCAAGCCCCTGAACTACGTCTGGGTGGACGACAAACATGCGTCGCGGATTTGTTTAGCTTGGGGTGCATCCTCTTTTATTGCATTACAGGGGGCAAACATCCATTTTGTGAGGATCAATTTGAGCGTGATGATAGGATTGTGATCAACATGTTCTTGTTGCATAAGCTCCCAGAAGCTTCAGATTTGATTTCTCAATTATTAGATCATGACCCTGAATTGAGATAA MGRAKFFPSDDSGYDVPVCATSCWQAPELRLGGRQTCVADLFSLGCILFYCITGGKHPFCEDQFERDDRIVINMFLLHKLPEASDLISQLLDHDPELR
BLAST of ClCG01G020860 vs. Swiss-Prot
Match: IRE1A_ARATH (Serine/threonine-protein kinase/endoribonuclease IRE1a OS=Arabidopsis thaliana GN=IRE1A PE=1 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 1.3e-18 Identity = 54/103 (52.43%), Postives = 67/103 (65.05%), Query Frame = 1
BLAST of ClCG01G020860 vs. Swiss-Prot
Match: IRE1B_ARATH (Serine/threonine-protein kinase/endoribonuclease IRE1b OS=Arabidopsis thaliana GN=IRE1B PE=2 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 7.9e-16 Identity = 48/105 (45.71%), Postives = 62/105 (59.05%), Query Frame = 1
BLAST of ClCG01G020860 vs. Swiss-Prot
Match: IRE1_YEAST (Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRE1 PE=1 SV=2) HSP 1 Score: 59.7 bits (143), Expect = 2.1e-08 Identity = 29/71 (40.85%), Postives = 43/71 (60.56%), Query Frame = 1
BLAST of ClCG01G020860 vs. Swiss-Prot
Match: IRLD_DICDI (Probable serine/threonine-protein kinase irlD OS=Dictyostelium discoideum GN=irlD PE=3 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 2.5e-06 Identity = 31/67 (46.27%), Postives = 41/67 (61.19%), Query Frame = 1
BLAST of ClCG01G020860 vs. Swiss-Prot
Match: IRLC_DICDI (Probable serine/threonine-protein kinase irlC OS=Dictyostelium discoideum GN=irlC PE=3 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 2.5e-06 Identity = 31/67 (46.27%), Postives = 41/67 (61.19%), Query Frame = 1
BLAST of ClCG01G020860 vs. TrEMBL
Match: B9S6W8_RICCO (Kinase, putative OS=Ricinus communis GN=RCOM_0875020 PE=4 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 8.7e-22 Identity = 61/103 (59.22%), Postives = 71/103 (68.93%), Query Frame = 1
BLAST of ClCG01G020860 vs. TrEMBL
Match: A0A067L997_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_22410 PE=4 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 4.1e-19 Identity = 58/103 (56.31%), Postives = 69/103 (66.99%), Query Frame = 1
BLAST of ClCG01G020860 vs. TrEMBL
Match: A0A0A0KFU7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G486760 PE=4 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 5.3e-19 Identity = 56/103 (54.37%), Postives = 70/103 (67.96%), Query Frame = 1
BLAST of ClCG01G020860 vs. TrEMBL
Match: A0A067FZE2_CITSI (Uncharacterized protein (Fragment) OS=Citrus sinensis GN=CISIN_1g037774mg PE=4 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 2.0e-18 Identity = 50/83 (60.24%), Postives = 62/83 (74.70%), Query Frame = 1
BLAST of ClCG01G020860 vs. TrEMBL
Match: A0A059AIR2_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_J02541 PE=4 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 2.0e-18 Identity = 56/103 (54.37%), Postives = 68/103 (66.02%), Query Frame = 1
BLAST of ClCG01G020860 vs. TAIR10
Match: AT2G17520.1 (AT2G17520.1 Endoribonuclease/protein kinase IRE1-like) HSP 1 Score: 93.6 bits (231), Expect = 7.3e-20 Identity = 54/103 (52.43%), Postives = 67/103 (65.05%), Query Frame = 1
BLAST of ClCG01G020860 vs. TAIR10
Match: AT5G24360.2 (AT5G24360.2 inositol requiring 1-1) HSP 1 Score: 84.3 bits (207), Expect = 4.4e-17 Identity = 48/105 (45.71%), Postives = 62/105 (59.05%), Query Frame = 1
BLAST of ClCG01G020860 vs. NCBI nr
Match: gi|255561453|ref|XP_002521737.1| (PREDICTED: serine/threonine-protein kinase/endoribonuclease IRE1a isoform X1 [Ricinus communis]) HSP 1 Score: 110.9 bits (276), Expect = 1.3e-21 Identity = 61/103 (59.22%), Postives = 71/103 (68.93%), Query Frame = 1
BLAST of ClCG01G020860 vs. NCBI nr
Match: gi|1000959806|ref|XP_015576349.1| (PREDICTED: serine/threonine-protein kinase/endoribonuclease IRE1a isoform X2 [Ricinus communis]) HSP 1 Score: 110.9 bits (276), Expect = 1.3e-21 Identity = 61/103 (59.22%), Postives = 71/103 (68.93%), Query Frame = 1
BLAST of ClCG01G020860 vs. NCBI nr
Match: gi|1000959812|ref|XP_015576351.1| (PREDICTED: serine/threonine-protein kinase/endoribonuclease IRE1a isoform X3 [Ricinus communis]) HSP 1 Score: 110.9 bits (276), Expect = 1.3e-21 Identity = 61/103 (59.22%), Postives = 71/103 (68.93%), Query Frame = 1
BLAST of ClCG01G020860 vs. NCBI nr
Match: gi|1000959815|ref|XP_015576352.1| (PREDICTED: serine/threonine-protein kinase/endoribonuclease IRE1a isoform X4 [Ricinus communis]) HSP 1 Score: 110.9 bits (276), Expect = 1.3e-21 Identity = 61/103 (59.22%), Postives = 71/103 (68.93%), Query Frame = 1
BLAST of ClCG01G020860 vs. NCBI nr
Match: gi|657948107|ref|XP_008393348.1| (PREDICTED: serine/threonine-protein kinase/endoribonuclease IRE1a-like [Malus domestica]) HSP 1 Score: 103.2 bits (256), Expect = 2.6e-19 Identity = 58/103 (56.31%), Postives = 70/103 (67.96%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |