ClCG01G010530 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGTTGATCACAGTGACAAGTTCACAGTTAGATTTGGTTGGTGGCTATGAACCAATAAAGAACATAGATGATCCACATATCCAAAGCCTAGGAGAATTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAAAAAGTGATTAGTGGAAAATTACAGATTGTGGCTGGGACCAACTACAACCTTCAATTAACGGCTCTTGAGGGGATTGTAAGCAAAACCTATGGAACCCTTGTATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGACCTATCCAACTAA ATGTTGTTGATCACAGTGACAAGTTCACAGTTAGATTTGGTTGGTGGCTATGAACCAATAAAGAACATAGATGATCCACATATCCAAAGCCTAGGAGAATTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAAAAAGTGATTAGTGGAAAATTACAGATTGTGGCTGGGACCAACTACAACCTTCAATTAACGGCTCTTGAGGGGATTGTAAGCAAAACCTATGGAACCCTTGTATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGACCTATCCAACTAA ATGTTGTTGATCACAGTGACAAGTTCACAGTTAGATTTGGTTGGTGGCTATGAACCAATAAAGAACATAGATGATCCACATATCCAAAGCCTAGGAGAATTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAAAAAGTGATTAGTGGAAAATTACAGATTGTGGCTGGGACCAACTACAACCTTCAATTAACGGCTCTTGAGGGGATTGTAAGCAAAACCTATGGAACCCTTGTATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGACCTATCCAACTAA MLLITVTSSQLDLVGGYEPIKNIDDPHIQSLGEFAVNEHNKQAKTQLKFEKVISGKLQIVAGTNYNLQLTALEGIVSKTYGTLVFTDLKNENHLINFYDLSN
BLAST of ClCG01G010530 vs. Swiss-Prot
Match: CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana GN=CYS5 PE=2 SV=2) HSP 1 Score: 81.6 bits (200), Expect = 5.3e-15 Identity = 39/86 (45.35%), Postives = 61/86 (70.93%), Query Frame = 1
BLAST of ClCG01G010530 vs. Swiss-Prot
Match: CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 8.5e-13 Identity = 41/100 (41.00%), Postives = 60/100 (60.00%), Query Frame = 1
BLAST of ClCG01G010530 vs. Swiss-Prot
Match: CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa PE=1 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 5.5e-12 Identity = 32/80 (40.00%), Postives = 50/80 (62.50%), Query Frame = 1
BLAST of ClCG01G010530 vs. Swiss-Prot
Match: CYT1_ORYSJ (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 67.4 bits (163), Expect = 1.0e-10 Identity = 33/73 (45.21%), Postives = 45/73 (61.64%), Query Frame = 1
BLAST of ClCG01G010530 vs. Swiss-Prot
Match: CYT4_ARATH (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana GN=CYS4 PE=3 SV=2) HSP 1 Score: 66.2 bits (160), Expect = 2.3e-10 Identity = 26/61 (42.62%), Postives = 43/61 (70.49%), Query Frame = 1
BLAST of ClCG01G010530 vs. TrEMBL
Match: A0A0A0LYM0_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G183070 PE=3 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 1.4e-35 Identity = 76/102 (74.51%), Postives = 90/102 (88.24%), Query Frame = 1
BLAST of ClCG01G010530 vs. TrEMBL
Match: A0A0A0LT34_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G182070 PE=3 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 2.3e-33 Identity = 76/103 (73.79%), Postives = 88/103 (85.44%), Query Frame = 1
BLAST of ClCG01G010530 vs. TrEMBL
Match: A0A103Y1R1_CYNCS (Cysteine proteinase inhibitor OS=Cynara cardunculus var. scolymus GN=Ccrd_020815 PE=3 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 2.8e-15 Identity = 44/86 (51.16%), Postives = 59/86 (68.60%), Query Frame = 1
BLAST of ClCG01G010530 vs. TrEMBL
Match: F6HRK8_VITVI (Cysteine proteinase inhibitor OS=Vitis vinifera GN=VIT_00s0187g00040 PE=3 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 2.8e-15 Identity = 41/73 (56.16%), Postives = 53/73 (72.60%), Query Frame = 1
BLAST of ClCG01G010530 vs. TrEMBL
Match: F6HRL4_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_00s0187g00110 PE=4 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 3.7e-15 Identity = 43/97 (44.33%), Postives = 62/97 (63.92%), Query Frame = 1
BLAST of ClCG01G010530 vs. TAIR10
Match: AT5G47550.1 (AT5G47550.1 Cystatin/monellin superfamily protein) HSP 1 Score: 81.6 bits (200), Expect = 3.0e-16 Identity = 39/86 (45.35%), Postives = 61/86 (70.93%), Query Frame = 1
BLAST of ClCG01G010530 vs. TAIR10
Match: AT4G16500.1 (AT4G16500.1 Cystatin/monellin superfamily protein) HSP 1 Score: 66.2 bits (160), Expect = 1.3e-11 Identity = 26/61 (42.62%), Postives = 43/61 (70.49%), Query Frame = 1
BLAST of ClCG01G010530 vs. TAIR10
Match: AT2G40880.1 (AT2G40880.1 cystatin A) HSP 1 Score: 57.4 bits (137), Expect = 6.0e-09 Identity = 29/74 (39.19%), Postives = 44/74 (59.46%), Query Frame = 1
BLAST of ClCG01G010530 vs. TAIR10
Match: AT5G12140.1 (AT5G12140.1 cystatin-1) HSP 1 Score: 55.8 bits (133), Expect = 1.8e-08 Identity = 31/90 (34.44%), Postives = 48/90 (53.33%), Query Frame = 1
BLAST of ClCG01G010530 vs. TAIR10
Match: AT3G12490.2 (AT3G12490.2 cystatin B) HSP 1 Score: 54.3 bits (129), Expect = 5.1e-08 Identity = 30/79 (37.97%), Postives = 44/79 (55.70%), Query Frame = 1
BLAST of ClCG01G010530 vs. NCBI nr
Match: gi|449467076|ref|XP_004151251.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 156.8 bits (395), Expect = 2.1e-35 Identity = 76/102 (74.51%), Postives = 90/102 (88.24%), Query Frame = 1
BLAST of ClCG01G010530 vs. NCBI nr
Match: gi|449467074|ref|XP_004151250.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 149.4 bits (376), Expect = 3.3e-33 Identity = 76/103 (73.79%), Postives = 88/103 (85.44%), Query Frame = 1
BLAST of ClCG01G010530 vs. NCBI nr
Match: gi|359495539|ref|XP_003635016.1| (PREDICTED: cysteine proteinase inhibitor 1-like [Vitis vinifera]) HSP 1 Score: 89.4 bits (220), Expect = 4.1e-15 Identity = 41/73 (56.16%), Postives = 53/73 (72.60%), Query Frame = 1
BLAST of ClCG01G010530 vs. NCBI nr
Match: gi|976914912|gb|KVI00924.1| (Cystatin [Cynara cardunculus var. scolymus]) HSP 1 Score: 89.4 bits (220), Expect = 4.1e-15 Identity = 44/86 (51.16%), Postives = 59/86 (68.60%), Query Frame = 1
BLAST of ClCG01G010530 vs. NCBI nr
Match: gi|297741794|emb|CBI33099.3| (unnamed protein product [Vitis vinifera]) HSP 1 Score: 89.4 bits (220), Expect = 4.1e-15 Identity = 41/73 (56.16%), Postives = 53/73 (72.60%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|