ClCG01G010520 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGTCGGTCACAACAACAAGTTCACCGTTAGATTTGGTCGGTGGCTATGAACCAATAAAAAACATAGATGATCGACATATCCAAAGCCTAGGAGAATTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAGAAAGTGATTAGTGGAAAATTACAGATTGTGGCTGGGACTAATTACAACCTTCGATTAACAGCTCTTGAGGGGACTGTAAGTAGAACCTATGCAACCCTTGTATTCCTTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGGCCTCTCCAACTAA ATGTTGTCGGTCACAACAACAAGTTCACCGTTAGATTTGGTCGGTGGCTATGAACCAATAAAAAACATAGATGATCGACATATCCAAAGCCTAGGAGAATTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAGAAAGTGATTAGTGGAAAATTACAGATTGTGGCTGGGACTAATTACAACCTTCGATTAACAGCTCTTGAGGGGACTGTAAGTAGAACCTATGCAACCCTTGTATTCCTTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGGCCTCTCCAACTAA ATGTTGTCGGTCACAACAACAAGTTCACCGTTAGATTTGGTCGGTGGCTATGAACCAATAAAAAACATAGATGATCGACATATCCAAAGCCTAGGAGAATTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAGAAAGTGATTAGTGGAAAATTACAGATTGTGGCTGGGACTAATTACAACCTTCGATTAACAGCTCTTGAGGGGACTGTAAGTAGAACCTATGCAACCCTTGTATTCCTTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGGCCTCTCCAACTAA MLSVTTTSSPLDLVGGYEPIKNIDDRHIQSLGEFAVNEHNKQAKTQLKFEKVISGKLQIVAGTNYNLRLTALEGTVSRTYATLVFLDLKNENHLINFYGLSN
BLAST of ClCG01G010520 vs. Swiss-Prot
Match: CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana GN=CYS5 PE=2 SV=2) HSP 1 Score: 77.4 bits (189), Expect = 1.0e-13 Identity = 35/73 (47.95%), Postives = 53/73 (72.60%), Query Frame = 1
BLAST of ClCG01G010520 vs. Swiss-Prot
Match: CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa PE=1 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 7.2e-12 Identity = 30/71 (42.25%), Postives = 47/71 (66.20%), Query Frame = 1
BLAST of ClCG01G010520 vs. Swiss-Prot
Match: CYT1_ORYSJ (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 67.8 bits (164), Expect = 7.9e-11 Identity = 32/73 (43.84%), Postives = 45/73 (61.64%), Query Frame = 1
BLAST of ClCG01G010520 vs. Swiss-Prot
Match: CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 3.0e-10 Identity = 36/86 (41.86%), Postives = 52/86 (60.47%), Query Frame = 1
BLAST of ClCG01G010520 vs. Swiss-Prot
Match: CYT4_ARATH (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana GN=CYS4 PE=3 SV=2) HSP 1 Score: 63.2 bits (152), Expect = 2.0e-09 Identity = 25/61 (40.98%), Postives = 42/61 (68.85%), Query Frame = 1
BLAST of ClCG01G010520 vs. TrEMBL
Match: A0A0A0LYM0_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G183070 PE=3 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 1.4e-35 Identity = 78/102 (76.47%), Postives = 89/102 (87.25%), Query Frame = 1
BLAST of ClCG01G010520 vs. TrEMBL
Match: A0A0A0LT34_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G182070 PE=3 SV=1) HSP 1 Score: 144.1 bits (362), Expect = 9.7e-32 Identity = 73/103 (70.87%), Postives = 87/103 (84.47%), Query Frame = 1
BLAST of ClCG01G010520 vs. TrEMBL
Match: A0A103Y1R1_CYNCS (Cysteine proteinase inhibitor OS=Cynara cardunculus var. scolymus GN=Ccrd_020815 PE=3 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 3.7e-15 Identity = 44/88 (50.00%), Postives = 59/88 (67.05%), Query Frame = 1
BLAST of ClCG01G010520 vs. TrEMBL
Match: F6HRK8_VITVI (Cysteine proteinase inhibitor OS=Vitis vinifera GN=VIT_00s0187g00040 PE=3 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 1.8e-14 Identity = 40/73 (54.79%), Postives = 52/73 (71.23%), Query Frame = 1
BLAST of ClCG01G010520 vs. TrEMBL
Match: A5B2E1_VITVI (Cysteine proteinase inhibitor OS=Vitis vinifera GN=VITISV_013491 PE=3 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 2.4e-14 Identity = 40/73 (54.79%), Postives = 52/73 (71.23%), Query Frame = 1
BLAST of ClCG01G010520 vs. TAIR10
Match: AT5G47550.1 (AT5G47550.1 Cystatin/monellin superfamily protein) HSP 1 Score: 77.4 bits (189), Expect = 5.6e-15 Identity = 35/73 (47.95%), Postives = 53/73 (72.60%), Query Frame = 1
BLAST of ClCG01G010520 vs. TAIR10
Match: AT4G16500.1 (AT4G16500.1 Cystatin/monellin superfamily protein) HSP 1 Score: 63.2 bits (152), Expect = 1.1e-10 Identity = 25/61 (40.98%), Postives = 42/61 (68.85%), Query Frame = 1
BLAST of ClCG01G010520 vs. TAIR10
Match: AT2G40880.1 (AT2G40880.1 cystatin A) HSP 1 Score: 57.8 bits (138), Expect = 4.6e-09 Identity = 28/75 (37.33%), Postives = 45/75 (60.00%), Query Frame = 1
BLAST of ClCG01G010520 vs. TAIR10
Match: AT5G12140.1 (AT5G12140.1 cystatin-1) HSP 1 Score: 55.8 bits (133), Expect = 1.8e-08 Identity = 30/90 (33.33%), Postives = 48/90 (53.33%), Query Frame = 1
BLAST of ClCG01G010520 vs. TAIR10
Match: AT3G12490.2 (AT3G12490.2 cystatin B) HSP 1 Score: 53.5 bits (127), Expect = 8.7e-08 Identity = 29/75 (38.67%), Postives = 42/75 (56.00%), Query Frame = 1
BLAST of ClCG01G010520 vs. NCBI nr
Match: gi|449467076|ref|XP_004151251.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 156.8 bits (395), Expect = 2.1e-35 Identity = 78/102 (76.47%), Postives = 89/102 (87.25%), Query Frame = 1
BLAST of ClCG01G010520 vs. NCBI nr
Match: gi|449467074|ref|XP_004151250.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 144.1 bits (362), Expect = 1.4e-31 Identity = 73/103 (70.87%), Postives = 87/103 (84.47%), Query Frame = 1
BLAST of ClCG01G010520 vs. NCBI nr
Match: gi|976914912|gb|KVI00924.1| (Cystatin [Cynara cardunculus var. scolymus]) HSP 1 Score: 89.0 bits (219), Expect = 5.3e-15 Identity = 44/88 (50.00%), Postives = 59/88 (67.05%), Query Frame = 1
BLAST of ClCG01G010520 vs. NCBI nr
Match: gi|359495539|ref|XP_003635016.1| (PREDICTED: cysteine proteinase inhibitor 1-like [Vitis vinifera]) HSP 1 Score: 86.7 bits (213), Expect = 2.6e-14 Identity = 40/73 (54.79%), Postives = 52/73 (71.23%), Query Frame = 1
BLAST of ClCG01G010520 vs. NCBI nr
Match: gi|297741794|emb|CBI33099.3| (unnamed protein product [Vitis vinifera]) HSP 1 Score: 86.7 bits (213), Expect = 2.6e-14 Identity = 40/73 (54.79%), Postives = 52/73 (71.23%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|