ClCG01G010490 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGTCGGTCACAGCGACAAGTTCACGGTTAGAGTTGGTCGGTGGCTATGAACCAATAAAGAACATAGAGGATCAACATATCCAAAGCCTAGGAGAGTTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAAACAGTGATTAGTGGAAAATTACAAATTGTGGCTGGGACCAACTACGGCCTTCAATTAACAGCTCTTGAGGGGAATGTAAGCAGAATCTATGGAACCCTTATATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGACCTCTCCAACTAA ATGTTGTCGGTCACAGCGACAAGTTCACGGTTAGAGTTGGTCGGTGGCTATGAACCAATAAAGAACATAGAGGATCAACATATCCAAAGCCTAGGAGAGTTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAAACAGTGATTAGTGGAAAATTACAAATTGTGGCTGGGACCAACTACGGCCTTCAATTAACAGCTCTTGAGGGGAATGTAAGCAGAATCTATGGAACCCTTATATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGACCTCTCCAACTAA ATGTTGTCGGTCACAGCGACAAGTTCACGGTTAGAGTTGGTCGGTGGCTATGAACCAATAAAGAACATAGAGGATCAACATATCCAAAGCCTAGGAGAGTTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAAACAGTGATTAGTGGAAAATTACAAATTGTGGCTGGGACCAACTACGGCCTTCAATTAACAGCTCTTGAGGGGAATGTAAGCAGAATCTATGGAACCCTTATATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGACCTCTCCAACTAA MLSVTATSSRLELVGGYEPIKNIEDQHIQSLGEFAVNEHNKQAKTQLKFETVISGKLQIVAGTNYGLQLTALEGNVSRIYGTLIFTDLKNENHLINFYDLSN
BLAST of ClCG01G010490 vs. Swiss-Prot
Match: CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana GN=CYS5 PE=2 SV=2) HSP 1 Score: 77.0 bits (188), Expect = 1.3e-13 Identity = 35/73 (47.95%), Postives = 55/73 (75.34%), Query Frame = 1
BLAST of ClCG01G010490 vs. Swiss-Prot
Match: CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa PE=1 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 2.7e-11 Identity = 30/76 (39.47%), Postives = 49/76 (64.47%), Query Frame = 1
BLAST of ClCG01G010490 vs. Swiss-Prot
Match: CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.4e-10 Identity = 38/100 (38.00%), Postives = 58/100 (58.00%), Query Frame = 1
BLAST of ClCG01G010490 vs. Swiss-Prot
Match: CYT1_ORYSJ (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 65.9 bits (159), Expect = 3.0e-10 Identity = 30/68 (44.12%), Postives = 43/68 (63.24%), Query Frame = 1
BLAST of ClCG01G010490 vs. Swiss-Prot
Match: CYT4_ARATH (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana GN=CYS4 PE=3 SV=2) HSP 1 Score: 60.1 bits (144), Expect = 1.7e-08 Identity = 24/61 (39.34%), Postives = 40/61 (65.57%), Query Frame = 1
BLAST of ClCG01G010490 vs. TrEMBL
Match: A0A0A0LYM0_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G183070 PE=3 SV=1) HSP 1 Score: 151.0 bits (380), Expect = 7.9e-34 Identity = 74/102 (72.55%), Postives = 88/102 (86.27%), Query Frame = 1
BLAST of ClCG01G010490 vs. TrEMBL
Match: A0A0A0LT34_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G182070 PE=3 SV=1) HSP 1 Score: 147.5 bits (371), Expect = 8.8e-33 Identity = 74/103 (71.84%), Postives = 88/103 (85.44%), Query Frame = 1
BLAST of ClCG01G010490 vs. TrEMBL
Match: F6HRK8_VITVI (Cysteine proteinase inhibitor OS=Vitis vinifera GN=VIT_00s0187g00040 PE=3 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 2.4e-14 Identity = 39/73 (53.42%), Postives = 53/73 (72.60%), Query Frame = 1
BLAST of ClCG01G010490 vs. TrEMBL
Match: A5B2E1_VITVI (Cysteine proteinase inhibitor OS=Vitis vinifera GN=VITISV_013491 PE=3 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 3.1e-14 Identity = 39/73 (53.42%), Postives = 53/73 (72.60%), Query Frame = 1
BLAST of ClCG01G010490 vs. TrEMBL
Match: A0A087HGA3_ARAAL (Cysteine proteinase inhibitor OS=Arabis alpina GN=AALP_AA2G092800 PE=3 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 2.0e-13 Identity = 39/85 (45.88%), Postives = 65/85 (76.47%), Query Frame = 1
BLAST of ClCG01G010490 vs. TAIR10
Match: AT5G47550.1 (AT5G47550.1 Cystatin/monellin superfamily protein) HSP 1 Score: 77.0 bits (188), Expect = 7.4e-15 Identity = 35/73 (47.95%), Postives = 55/73 (75.34%), Query Frame = 1
BLAST of ClCG01G010490 vs. TAIR10
Match: AT4G16500.1 (AT4G16500.1 Cystatin/monellin superfamily protein) HSP 1 Score: 60.1 bits (144), Expect = 9.3e-10 Identity = 24/61 (39.34%), Postives = 40/61 (65.57%), Query Frame = 1
BLAST of ClCG01G010490 vs. TAIR10
Match: AT5G12140.1 (AT5G12140.1 cystatin-1) HSP 1 Score: 54.3 bits (129), Expect = 5.1e-08 Identity = 29/90 (32.22%), Postives = 46/90 (51.11%), Query Frame = 1
BLAST of ClCG01G010490 vs. TAIR10
Match: AT2G40880.1 (AT2G40880.1 cystatin A) HSP 1 Score: 52.8 bits (125), Expect = 1.5e-07 Identity = 26/73 (35.62%), Postives = 42/73 (57.53%), Query Frame = 1
BLAST of ClCG01G010490 vs. TAIR10
Match: AT3G12490.2 (AT3G12490.2 cystatin B) HSP 1 Score: 52.4 bits (124), Expect = 1.9e-07 Identity = 28/74 (37.84%), Postives = 39/74 (52.70%), Query Frame = 1
BLAST of ClCG01G010490 vs. NCBI nr
Match: gi|449467076|ref|XP_004151251.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 151.0 bits (380), Expect = 1.1e-33 Identity = 74/102 (72.55%), Postives = 88/102 (86.27%), Query Frame = 1
BLAST of ClCG01G010490 vs. NCBI nr
Match: gi|449467074|ref|XP_004151250.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 147.5 bits (371), Expect = 1.3e-32 Identity = 74/103 (71.84%), Postives = 88/103 (85.44%), Query Frame = 1
BLAST of ClCG01G010490 vs. NCBI nr
Match: gi|359495539|ref|XP_003635016.1| (PREDICTED: cysteine proteinase inhibitor 1-like [Vitis vinifera]) HSP 1 Score: 86.3 bits (212), Expect = 3.4e-14 Identity = 39/73 (53.42%), Postives = 53/73 (72.60%), Query Frame = 1
BLAST of ClCG01G010490 vs. NCBI nr
Match: gi|297741794|emb|CBI33099.3| (unnamed protein product [Vitis vinifera]) HSP 1 Score: 86.3 bits (212), Expect = 3.4e-14 Identity = 39/73 (53.42%), Postives = 53/73 (72.60%), Query Frame = 1
BLAST of ClCG01G010490 vs. NCBI nr
Match: gi|147854421|emb|CAN82794.1| (hypothetical protein VITISV_013491 [Vitis vinifera]) HSP 1 Score: 85.9 bits (211), Expect = 4.5e-14 Identity = 39/73 (53.42%), Postives = 53/73 (72.60%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|