ClCG01G010470 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGTCGGTCACAGTGACAAGTTCAAGGTTAGATTTGGTTGGTGGCTATGAACCAATAAAGAACATAGCTGATCCACATATCCAAAGCCTAGGAGAGTTTGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAAAAAGTGAATAGTGGAAAATTACAGATTGTGGCTGGGACCAACTACGACCTTCGATTAACAGCTCTTGAGGGGACTGTAAGCAGAACCTATGGAACCCTTGTATTCACTGATCTAAAGAATGGGAACCATCTTATCAACTTCTATGGCCTCTCCAACTAA ATGTTGTCGGTCACAGTGACAAGTTCAAGGTTAGATTTGGTTGGTGGCTATGAACCAATAAAGAACATAGCTGATCCACATATCCAAAGCCTAGGAGAGTTTGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAAAAAGTGAATAGTGGAAAATTACAGATTGTGGCTGGGACCAACTACGACCTTCGATTAACAGCTCTTGAGGGGACTGTAAGCAGAACCTATGGAACCCTTGTATTCACTGATCTAAAGAATGGGAACCATCTTATCAACTTCTATGGCCTCTCCAACTAA ATGTTGTCGGTCACAGTGACAAGTTCAAGGTTAGATTTGGTTGGTGGCTATGAACCAATAAAGAACATAGCTGATCCACATATCCAAAGCCTAGGAGAGTTTGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAAAAAGTGAATAGTGGAAAATTACAGATTGTGGCTGGGACCAACTACGACCTTCGATTAACAGCTCTTGAGGGGACTGTAAGCAGAACCTATGGAACCCTTGTATTCACTGATCTAAAGAATGGGAACCATCTTATCAACTTCTATGGCCTCTCCAACTAA MLSVTVTSSRLDLVGGYEPIKNIADPHIQSLGEFAVNEHNKQAKTQLKFEKVNSGKLQIVAGTNYDLRLTALEGTVSRTYGTLVFTDLKNGNHLINFYGLSN
BLAST of ClCG01G010470 vs. Swiss-Prot
Match: CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana GN=CYS5 PE=2 SV=2) HSP 1 Score: 77.0 bits (188), Expect = 1.3e-13 Identity = 36/73 (49.32%), Postives = 53/73 (72.60%), Query Frame = 1
BLAST of ClCG01G010470 vs. Swiss-Prot
Match: CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa PE=1 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 4.6e-11 Identity = 35/85 (41.18%), Postives = 50/85 (58.82%), Query Frame = 1
BLAST of ClCG01G010470 vs. Swiss-Prot
Match: CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 6.1e-11 Identity = 37/86 (43.02%), Postives = 53/86 (61.63%), Query Frame = 1
BLAST of ClCG01G010470 vs. Swiss-Prot
Match: CYT4_ARATH (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana GN=CYS4 PE=3 SV=2) HSP 1 Score: 66.6 bits (161), Expect = 1.8e-10 Identity = 27/61 (44.26%), Postives = 43/61 (70.49%), Query Frame = 1
BLAST of ClCG01G010470 vs. Swiss-Prot
Match: CYT1_ORYSJ (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 63.2 bits (152), Expect = 2.0e-09 Identity = 32/73 (43.84%), Postives = 43/73 (58.90%), Query Frame = 1
BLAST of ClCG01G010470 vs. TrEMBL
Match: A0A0A0LYM0_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G183070 PE=3 SV=1) HSP 1 Score: 165.6 bits (418), Expect = 3.1e-38 Identity = 82/102 (80.39%), Postives = 92/102 (90.20%), Query Frame = 1
BLAST of ClCG01G010470 vs. TrEMBL
Match: A0A0A0LT34_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G182070 PE=3 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 6.7e-33 Identity = 74/103 (71.84%), Postives = 89/103 (86.41%), Query Frame = 1
BLAST of ClCG01G010470 vs. TrEMBL
Match: A0A103Y1R1_CYNCS (Cysteine proteinase inhibitor OS=Cynara cardunculus var. scolymus GN=Ccrd_020815 PE=3 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 8.2e-15 Identity = 44/88 (50.00%), Postives = 59/88 (67.05%), Query Frame = 1
BLAST of ClCG01G010470 vs. TrEMBL
Match: F6HRK8_VITVI (Cysteine proteinase inhibitor OS=Vitis vinifera GN=VIT_00s0187g00040 PE=3 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 1.4e-14 Identity = 41/73 (56.16%), Postives = 53/73 (72.60%), Query Frame = 1
BLAST of ClCG01G010470 vs. TrEMBL
Match: A5B2E1_VITVI (Cysteine proteinase inhibitor OS=Vitis vinifera GN=VITISV_013491 PE=3 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 1.8e-14 Identity = 41/73 (56.16%), Postives = 53/73 (72.60%), Query Frame = 1
BLAST of ClCG01G010470 vs. TAIR10
Match: AT5G47550.1 (AT5G47550.1 Cystatin/monellin superfamily protein) HSP 1 Score: 77.0 bits (188), Expect = 7.4e-15 Identity = 36/73 (49.32%), Postives = 53/73 (72.60%), Query Frame = 1
BLAST of ClCG01G010470 vs. TAIR10
Match: AT4G16500.1 (AT4G16500.1 Cystatin/monellin superfamily protein) HSP 1 Score: 66.6 bits (161), Expect = 1.0e-11 Identity = 27/61 (44.26%), Postives = 43/61 (70.49%), Query Frame = 1
BLAST of ClCG01G010470 vs. TAIR10
Match: AT2G40880.1 (AT2G40880.1 cystatin A) HSP 1 Score: 52.8 bits (125), Expect = 1.5e-07 Identity = 28/74 (37.84%), Postives = 41/74 (55.41%), Query Frame = 1
BLAST of ClCG01G010470 vs. TAIR10
Match: AT5G12140.1 (AT5G12140.1 cystatin-1) HSP 1 Score: 51.6 bits (122), Expect = 3.3e-07 Identity = 30/90 (33.33%), Postives = 45/90 (50.00%), Query Frame = 1
BLAST of ClCG01G010470 vs. TAIR10
Match: AT3G12490.2 (AT3G12490.2 cystatin B) HSP 1 Score: 48.9 bits (115), Expect = 2.1e-06 Identity = 29/79 (36.71%), Postives = 40/79 (50.63%), Query Frame = 1
BLAST of ClCG01G010470 vs. NCBI nr
Match: gi|449467076|ref|XP_004151251.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 165.6 bits (418), Expect = 4.5e-38 Identity = 82/102 (80.39%), Postives = 92/102 (90.20%), Query Frame = 1
BLAST of ClCG01G010470 vs. NCBI nr
Match: gi|449467074|ref|XP_004151250.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 147.9 bits (372), Expect = 9.6e-33 Identity = 74/103 (71.84%), Postives = 89/103 (86.41%), Query Frame = 1
BLAST of ClCG01G010470 vs. NCBI nr
Match: gi|976914912|gb|KVI00924.1| (Cystatin [Cynara cardunculus var. scolymus]) HSP 1 Score: 87.8 bits (216), Expect = 1.2e-14 Identity = 44/88 (50.00%), Postives = 59/88 (67.05%), Query Frame = 1
BLAST of ClCG01G010470 vs. NCBI nr
Match: gi|297741794|emb|CBI33099.3| (unnamed protein product [Vitis vinifera]) HSP 1 Score: 87.0 bits (214), Expect = 2.0e-14 Identity = 41/73 (56.16%), Postives = 53/73 (72.60%), Query Frame = 1
BLAST of ClCG01G010470 vs. NCBI nr
Match: gi|359495539|ref|XP_003635016.1| (PREDICTED: cysteine proteinase inhibitor 1-like [Vitis vinifera]) HSP 1 Score: 87.0 bits (214), Expect = 2.0e-14 Identity = 41/73 (56.16%), Postives = 53/73 (72.60%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|