ClCG01G006850 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTGAAACCAACAATGATCAAACTCCCACCATTCCTCTCCTCACTCCTTACAAGATGGGGAAGTTTAATCTTTCTCACAGGTACTTCCATCCATTTTTCACCATTTGCATCTTCCTGTCTTTCAAGTATGATAATTTTTACCATATTCACCATCTTCAATCCCTGCCTTGCTTATTAGATCTTCTTCTCATCAATAATTATTCTTCAGAATCGTTTTGGCTCCATTGACAAGGCACAGATCTTACAACAATGTTCCCCAGAAACATGCCATCTTGTATTACTCCCAGAGAACCACCAAAGGGGGTTTCTTGATAGCTGAGGCTACTGGGATTTCTGATAATGCCCAAGGGTAA ATGGGTGAAACCAACAATGATCAAACTCCCACCATTCCTCTCCTCACTCCTTACAAGATGGGGAAGTTTAATCTTTCTCACAGAATCGTTTTGGCTCCATTGACAAGGCACAGATCTTACAACAATGTTCCCCAGAAACATGCCATCTTGTATTACTCCCAGAGAACCACCAAAGGGGGTTTCTTGATAGCTGAGGCTACTGGGATTTCTGATAATGCCCAAGGGTAA ATGGGTGAAACCAACAATGATCAAACTCCCACCATTCCTCTCCTCACTCCTTACAAGATGGGGAAGTTTAATCTTTCTCACAGAATCGTTTTGGCTCCATTGACAAGGCACAGATCTTACAACAATGTTCCCCAGAAACATGCCATCTTGTATTACTCCCAGAGAACCACCAAAGGGGGTTTCTTGATAGCTGAGGCTACTGGGATTTCTGATAATGCCCAAGGGTAA MGETNNDQTPTIPLLTPYKMGKFNLSHRIVLAPLTRHRSYNNVPQKHAILYYSQRTTKGGFLIAEATGISDNAQG
BLAST of ClCG01G006850 vs. Swiss-Prot
Match: OPR1_ARATH (12-oxophytodienoate reductase 1 OS=Arabidopsis thaliana GN=OPR1 PE=1 SV=2) HSP 1 Score: 116.7 bits (291), Expect = 1.1e-25 Identity = 53/71 (74.65%), Postives = 58/71 (81.69%), Query Frame = 1
BLAST of ClCG01G006850 vs. Swiss-Prot
Match: OPR2_ARATH (12-oxophytodienoate reductase 2 OS=Arabidopsis thaliana GN=OPR2 PE=1 SV=2) HSP 1 Score: 115.9 bits (289), Expect = 1.9e-25 Identity = 54/75 (72.00%), Postives = 61/75 (81.33%), Query Frame = 1
BLAST of ClCG01G006850 vs. Swiss-Prot
Match: OPR11_ORYSJ (Putative 12-oxophytodienoate reductase 11 OS=Oryza sativa subsp. japonica GN=OPR11 PE=2 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 1.9e-25 Identity = 55/65 (84.62%), Postives = 56/65 (86.15%), Query Frame = 1
BLAST of ClCG01G006850 vs. Swiss-Prot
Match: OPR4_ORYSJ (Putative 12-oxophytodienoate reductase 4 OS=Oryza sativa subsp. japonica GN=OPR4 PE=2 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 3.9e-23 Identity = 48/64 (75.00%), Postives = 54/64 (84.38%), Query Frame = 1
BLAST of ClCG01G006850 vs. Swiss-Prot
Match: OPR12_ORYSJ (Putative 12-oxophytodienoate reductase 12 OS=Oryza sativa subsp. japonica GN=OPR12 PE=2 SV=2) HSP 1 Score: 104.8 bits (260), Expect = 4.3e-22 Identity = 49/64 (76.56%), Postives = 54/64 (84.38%), Query Frame = 1
BLAST of ClCG01G006850 vs. TrEMBL
Match: A0A0A0KLJ7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G098480 PE=4 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 4.9e-33 Identity = 69/75 (92.00%), Postives = 74/75 (98.67%), Query Frame = 1
BLAST of ClCG01G006850 vs. TrEMBL
Match: A0A0A0LMD3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G395815 PE=4 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 4.0e-27 Identity = 65/79 (82.28%), Postives = 69/79 (87.34%), Query Frame = 1
BLAST of ClCG01G006850 vs. TrEMBL
Match: M5XSJ3_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa007381mg PE=4 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 7.6e-26 Identity = 58/68 (85.29%), Postives = 63/68 (92.65%), Query Frame = 1
BLAST of ClCG01G006850 vs. TrEMBL
Match: A0A067DIG5_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g015862mg PE=4 SV=1) HSP 1 Score: 123.6 bits (309), Expect = 1.0e-25 Identity = 61/77 (79.22%), Postives = 65/77 (84.42%), Query Frame = 1
BLAST of ClCG01G006850 vs. TrEMBL
Match: A0A067DPN7_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g017448mg PE=4 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 1.3e-25 Identity = 58/67 (86.57%), Postives = 62/67 (92.54%), Query Frame = 1
BLAST of ClCG01G006850 vs. TAIR10
Match: AT1G76680.2 (AT1G76680.2 12-oxophytodienoate reductase 1) HSP 1 Score: 116.7 bits (291), Expect = 6.2e-27 Identity = 53/71 (74.65%), Postives = 58/71 (81.69%), Query Frame = 1
BLAST of ClCG01G006850 vs. TAIR10
Match: AT1G76690.1 (AT1G76690.1 12-oxophytodienoate reductase 2) HSP 1 Score: 115.9 bits (289), Expect = 1.1e-26 Identity = 54/75 (72.00%), Postives = 61/75 (81.33%), Query Frame = 1
BLAST of ClCG01G006850 vs. TAIR10
Match: AT1G17990.1 (AT1G17990.1 FMN-linked oxidoreductases superfamily protein) HSP 1 Score: 92.8 bits (229), Expect = 9.5e-20 Identity = 43/65 (66.15%), Postives = 51/65 (78.46%), Query Frame = 1
BLAST of ClCG01G006850 vs. TAIR10
Match: AT1G18020.1 (AT1G18020.1 FMN-linked oxidoreductases superfamily protein) HSP 1 Score: 92.8 bits (229), Expect = 9.5e-20 Identity = 43/65 (66.15%), Postives = 51/65 (78.46%), Query Frame = 1
BLAST of ClCG01G006850 vs. TAIR10
Match: AT1G09400.1 (AT1G09400.1 FMN-linked oxidoreductases superfamily protein) HSP 1 Score: 78.6 bits (192), Expect = 1.9e-15 Identity = 35/54 (64.81%), Postives = 40/54 (74.07%), Query Frame = 1
BLAST of ClCG01G006850 vs. NCBI nr
Match: gi|659072708|ref|XP_008466854.1| (PREDICTED: 12-oxophytodienoate reductase 2-like [Cucumis melo]) HSP 1 Score: 149.4 bits (376), Expect = 2.4e-33 Identity = 70/75 (93.33%), Postives = 74/75 (98.67%), Query Frame = 1
BLAST of ClCG01G006850 vs. NCBI nr
Match: gi|449464874|ref|XP_004150154.1| (PREDICTED: 12-oxophytodienoate reductase 2-like [Cucumis sativus]) HSP 1 Score: 147.9 bits (372), Expect = 7.1e-33 Identity = 69/75 (92.00%), Postives = 74/75 (98.67%), Query Frame = 1
BLAST of ClCG01G006850 vs. NCBI nr
Match: gi|659081096|ref|XP_008441149.1| (PREDICTED: putative 12-oxophytodienoate reductase 11 [Cucumis melo]) HSP 1 Score: 129.4 bits (324), Expect = 2.6e-27 Identity = 66/79 (83.54%), Postives = 69/79 (87.34%), Query Frame = 1
BLAST of ClCG01G006850 vs. NCBI nr
Match: gi|778672814|ref|XP_004138673.2| (PREDICTED: 12-oxophytodienoate reductase 1 [Cucumis sativus]) HSP 1 Score: 128.3 bits (321), Expect = 5.8e-27 Identity = 65/79 (82.28%), Postives = 69/79 (87.34%), Query Frame = 1
BLAST of ClCG01G006850 vs. NCBI nr
Match: gi|568848887|ref|XP_006478217.1| (PREDICTED: putative 12-oxophytodienoate reductase 11 [Citrus sinensis]) HSP 1 Score: 127.1 bits (318), Expect = 1.3e-26 Identity = 62/77 (80.52%), Postives = 66/77 (85.71%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|