ClCG01G001970 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAATCCGAAGCTAAGAAGACTGCAAAACAGCCACGAAAACAGTCCAAGAGCAGGAACTCGAGCTCGGAAGGTGTCTTGATTTTTCTGGTTTTTCTGCCATGGCTACTGAGAAGTGAGAACTTTTTTGGTTGGTAAAGGAAGTTGTTATAGCTGTTTTTCATTTTTAATGTGTTTGTTTTGTAGAAGTTACCAGTTTGGAATGGGAGGTCGTTCAAATCAGTGAGCAGGAGGAGGATCTCATTCATAGAATGCACAGACTTGTTGGAGACAGGTTCTATGTCTCTCTCTTTCAAATGGCTCTCTCTTTTTCTACGAAAAATTCGATGATTCTCCGCCATCAACATTCTCGTTCTGAACATGTTTTATTACTGTTACATTGAACTTCAGGTGGGATTTGATCGCGGGACGAATTCCAGGACGAACTGCAGTAGAAATTGAGAGGTTTTGGATATTGAAACATGGTTCCTGA ATGGAATCCGAAGCTAAGAAGACTGCAAAACAGCCACGAAAACAGTCCAAGAGCAGGAACTCGAGCTCGGAAGGTGTCTTGATTTTTCTGGTTTTTCTGCCATGGCTACTGAGAAAAGTTACCAGTTTGGAATGGGAGGTCGTTCAAATCAGTGAGCAGGAGGAGGATCTCATTCATAGAATGCACAGACTTGTTGGAGACAGGTGGGATTTGATCGCGGGACGAATTCCAGGACGAACTGCAGTAGAAATTGAGAGGTTTTGGATATTGAAACATGGTTCCTGA ATGGAATCCGAAGCTAAGAAGACTGCAAAACAGCCACGAAAACAGTCCAAGAGCAGGAACTCGAGCTCGGAAGGTGTCTTGATTTTTCTGGTTTTTCTGCCATGGCTACTGAGAAAAGTTACCAGTTTGGAATGGGAGGTCGTTCAAATCAGTGAGCAGGAGGAGGATCTCATTCATAGAATGCACAGACTTGTTGGAGACAGGTGGGATTTGATCGCGGGACGAATTCCAGGACGAACTGCAGTAGAAATTGAGAGGTTTTGGATATTGAAACATGGTTCCTGA MESEAKKTAKQPRKQSKSRNSSSEGVLIFLVFLPWLLRKVTSLEWEVVQISEQEEDLIHRMHRLVGDRWDLIAGRIPGRTAVEIERFWILKHGS
BLAST of ClCG01G001970 vs. Swiss-Prot
Match: CPC_ARATH (Transcription factor CPC OS=Arabidopsis thaliana GN=CPC PE=1 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 1.0e-20 Identity = 49/90 (54.44%), Postives = 65/90 (72.22%), Query Frame = 1
BLAST of ClCG01G001970 vs. Swiss-Prot
Match: ETC3_ARATH (MYB-like transcription factor ETC3 OS=Arabidopsis thaliana GN=ETC3 PE=2 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 1.6e-18 Identity = 40/54 (74.07%), Postives = 50/54 (92.59%), Query Frame = 1
BLAST of ClCG01G001970 vs. Swiss-Prot
Match: ETC1_ARATH (MYB-like transcription factor ETC1 OS=Arabidopsis thaliana GN=ETC1 PE=2 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 1.5e-16 Identity = 37/54 (68.52%), Postives = 48/54 (88.89%), Query Frame = 1
BLAST of ClCG01G001970 vs. Swiss-Prot
Match: TRY_ARATH (Transcription factor TRY OS=Arabidopsis thaliana GN=TRY PE=1 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 2.6e-16 Identity = 36/54 (66.67%), Postives = 46/54 (85.19%), Query Frame = 1
BLAST of ClCG01G001970 vs. Swiss-Prot
Match: TCL2_ARATH (MYB-like transcription factor TCL2 OS=Arabidopsis thaliana GN=TCL2 PE=1 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 1.7e-15 Identity = 35/54 (64.81%), Postives = 45/54 (83.33%), Query Frame = 1
BLAST of ClCG01G001970 vs. TrEMBL
Match: A0A061G715_THECC (Homeodomain-like superfamily protein OS=Theobroma cacao GN=TCM_016428 PE=4 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 1.1e-18 Identity = 47/84 (55.95%), Postives = 65/84 (77.38%), Query Frame = 1
BLAST of ClCG01G001970 vs. TrEMBL
Match: B9I543_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0012s01420g PE=4 SV=2) HSP 1 Score: 100.1 bits (248), Expect = 1.5e-18 Identity = 52/92 (56.52%), Postives = 66/92 (71.74%), Query Frame = 1
BLAST of ClCG01G001970 vs. TrEMBL
Match: B9N984_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0015s02310g PE=4 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 3.3e-18 Identity = 49/83 (59.04%), Postives = 60/83 (72.29%), Query Frame = 1
BLAST of ClCG01G001970 vs. TrEMBL
Match: R0FYS9_9BRAS (Uncharacterized protein OS=Capsella rubella GN=CARUB_v10024406mg PE=4 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 3.3e-18 Identity = 48/90 (53.33%), Postives = 66/90 (73.33%), Query Frame = 1
BLAST of ClCG01G001970 vs. TrEMBL
Match: A0A0C4ZP98_9ROSI (R3 MYB repressor protein OS=Populus tremula x Populus tremuloides GN=MYB179 PE=2 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 7.3e-18 Identity = 48/83 (57.83%), Postives = 60/83 (72.29%), Query Frame = 1
BLAST of ClCG01G001970 vs. TAIR10
Match: AT2G46410.1 (AT2G46410.1 Homeodomain-like superfamily protein) HSP 1 Score: 100.5 bits (249), Expect = 5.7e-22 Identity = 49/90 (54.44%), Postives = 65/90 (72.22%), Query Frame = 1
BLAST of ClCG01G001970 vs. TAIR10
Match: AT4G01060.1 (AT4G01060.1 CAPRICE-like MYB3) HSP 1 Score: 95.5 bits (236), Expect = 1.8e-20 Identity = 49/86 (56.98%), Postives = 60/86 (69.77%), Query Frame = 1
BLAST of ClCG01G001970 vs. TAIR10
Match: AT1G01380.1 (AT1G01380.1 Homeodomain-like superfamily protein) HSP 1 Score: 86.7 bits (213), Expect = 8.6e-18 Identity = 37/54 (68.52%), Postives = 48/54 (88.89%), Query Frame = 1
BLAST of ClCG01G001970 vs. TAIR10
Match: AT5G53200.1 (AT5G53200.1 Homeodomain-like superfamily protein) HSP 1 Score: 85.9 bits (211), Expect = 1.5e-17 Identity = 36/54 (66.67%), Postives = 46/54 (85.19%), Query Frame = 1
BLAST of ClCG01G001970 vs. TAIR10
Match: AT2G30424.1 (AT2G30424.1 Homeodomain-like superfamily protein) HSP 1 Score: 83.2 bits (204), Expect = 9.5e-17 Identity = 35/54 (64.81%), Postives = 45/54 (83.33%), Query Frame = 1
BLAST of ClCG01G001970 vs. NCBI nr
Match: gi|15225977|ref|NP_182164.1| (transcription factor CPC [Arabidopsis thaliana]) HSP 1 Score: 100.5 bits (249), Expect = 1.6e-18 Identity = 49/90 (54.44%), Postives = 67/90 (74.44%), Query Frame = 1
BLAST of ClCG01G001970 vs. NCBI nr
Match: gi|590679086|ref|XP_007040481.1| (Homeodomain-like superfamily protein [Theobroma cacao]) HSP 1 Score: 100.5 bits (249), Expect = 1.6e-18 Identity = 47/84 (55.95%), Postives = 65/84 (77.38%), Query Frame = 1
BLAST of ClCG01G001970 vs. NCBI nr
Match: gi|566196230|ref|XP_002317748.2| (hypothetical protein POPTR_0012s01420g [Populus trichocarpa]) HSP 1 Score: 100.1 bits (248), Expect = 2.1e-18 Identity = 52/92 (56.52%), Postives = 66/92 (71.74%), Query Frame = 1
BLAST of ClCG01G001970 vs. NCBI nr
Match: gi|566205533|ref|XP_006374132.1| (hypothetical protein POPTR_0015s02310g [Populus trichocarpa]) HSP 1 Score: 99.0 bits (245), Expect = 4.7e-18 Identity = 49/83 (59.04%), Postives = 60/83 (72.29%), Query Frame = 1
BLAST of ClCG01G001970 vs. NCBI nr
Match: gi|743927497|ref|XP_011007923.1| (PREDICTED: MYB-like transcription factor ETC3 [Populus euphratica]) HSP 1 Score: 99.0 bits (245), Expect = 4.7e-18 Identity = 49/83 (59.04%), Postives = 60/83 (72.29%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |