Carg27930 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGGTTAAAGAAGGAAGTCTAGTTGGAAAATATGAGTCTCTTGTACAGACTACCATAATACCTAAAGGCAAGGAGCAGTCTTCTTTGAGGGGAGATAACATTTTTCCAAAAGGCGTGACTGGTAAATTACAAGAAATCTTGAATAGGGTAAAAAATCCATCGAAAAGTGAAATATATGATGACCTTTATGGAGAATCATTTTCGGGAAATGTGGGTACGTCGTGGGCATATTCTCCTAGTACTGCTAATAACCCGTCTTCCCCTCCTAAAGACTTGATTGGTAAAGCTTCAAGTGGGAACCATGAAGTAGATAACAGGACCAATATGAATAATGACAGTGATGATGATTTGTTT ATGGGGGTTAAAGAAGGAAGTCTAGTTGGAAAATATGAGTCTCTTGTACAGACTACCATAATACCTAAAGGCAAGGAGCAGTCTTCTTTGAGGGGAGATAACATTTTTCCAAAAGGCGTGACTGGTAAATTACAAGAAATCTTGAATAGGGTAAAAAATCCATCGAAAAGTGAAATATATGATGACCTTTATGGAGAATCATTTTCGGGAAATGTGGGTACGTCGTGGGCATATTCTCCTAGTACTGCTAATAACCCGTCTTCCCCTCCTAAAGACTTGATTGGTAAAGCTTCAAGTGGGAACCATGAAGTAGATAACAGGACCAATATGAATAATGACAGTGATGATGATTTGTTT ATGGGGGTTAAAGAAGGAAGTCTAGTTGGAAAATATGAGTCTCTTGTACAGACTACCATAATACCTAAAGGCAAGGAGCAGTCTTCTTTGAGGGGAGATAACATTTTTCCAAAAGGCGTGACTGGTAAATTACAAGAAATCTTGAATAGGGTAAAAAATCCATCGAAAAGTGAAATATATGATGACCTTTATGGAGAATCATTTTCGGGAAATGTGGGTACGTCGTGGGCATATTCTCCTAGTACTGCTAATAACCCGTCTTCCCCTCCTAAAGACTTGATTGGTAAAGCTTCAAGTGGGAACCATGAAGTAGATAACAGGACCAATATGAATAATGACAGTGATGATGATTTGTTT MGVKEGSLVGKYESLVQTTIIPKGKEQSSLRGDNIFPKGVTGKLQEILNRVKNPSKSEIYDDLYGESFSGNVGTSWAYSPSTANNPSSPPKDLIGKASSGNHEVDNRTNMNNDSDDDLF
BLAST of Carg27930 vs. NCBI nr
Match: XP_022142477.1 (nuclear inhibitor of protein phosphatase 1 [Momordica charantia]) HSP 1 Score: 199.5 bits (506), Expect = 6.3e-48 Identity = 102/120 (85.00%), Postives = 109/120 (90.83%), Query Frame = 0
BLAST of Carg27930 vs. NCBI nr
Match: XP_023519780.1 (protein phosphatase 1 regulatory inhibitor subunit PPP1R8 homolog [Cucurbita pepo subsp. pepo]) HSP 1 Score: 196.8 bits (499), Expect = 4.1e-47 Identity = 105/120 (87.50%), Postives = 110/120 (91.67%), Query Frame = 0
BLAST of Carg27930 vs. NCBI nr
Match: XP_022973135.1 (protein phosphatase 1 regulatory inhibitor subunit PPP1R8 homolog [Cucurbita maxima]) HSP 1 Score: 195.3 bits (495), Expect = 1.2e-46 Identity = 104/120 (86.67%), Postives = 110/120 (91.67%), Query Frame = 0
BLAST of Carg27930 vs. NCBI nr
Match: XP_022927131.1 (protein phosphatase 1 regulatory inhibitor subunit PPP1R8 homolog [Cucurbita moschata]) HSP 1 Score: 194.9 bits (494), Expect = 1.6e-46 Identity = 104/120 (86.67%), Postives = 109/120 (90.83%), Query Frame = 0
BLAST of Carg27930 vs. NCBI nr
Match: XP_004139507.1 (PREDICTED: nuclear inhibitor of protein phosphatase 1 [Cucumis sativus] >XP_004139508.1 PREDICTED: nuclear inhibitor of protein phosphatase 1 [Cucumis sativus] >XP_011654685.1 PREDICTED: nuclear inhibitor of protein phosphatase 1 [Cucumis sativus] >XP_011654689.1 PREDICTED: nuclear inhibitor of protein phosphatase 1 [Cucumis sativus] >KGN64977.1 hypothetical protein Csa_1G170010 [Cucumis sativus]) HSP 1 Score: 179.9 bits (455), Expect = 5.2e-42 Identity = 98/120 (81.67%), Postives = 105/120 (87.50%), Query Frame = 0
BLAST of Carg27930 vs. TAIR10
Match: AT5G47790.1 (SMAD/FHA domain-containing protein ) HSP 1 Score: 79.0 bits (193), Expect = 2.3e-15 Identity = 43/78 (55.13%), Postives = 53/78 (67.95%), Query Frame = 0
BLAST of Carg27930 vs. Swiss-Prot
Match: sp|Q9FIK2|PP1R8_ARATH (Protein phosphatase 1 regulatory inhibitor subunit PPP1R8 homolog OS=Arabidopsis thaliana OX=3702 GN=At5g47790 PE=1 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 4.1e-14 Identity = 43/78 (55.13%), Postives = 53/78 (67.95%), Query Frame = 0
BLAST of Carg27930 vs. TrEMBL
Match: tr|A0A0A0LVY0|A0A0A0LVY0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G170010 PE=4 SV=1) HSP 1 Score: 179.9 bits (455), Expect = 3.4e-42 Identity = 98/120 (81.67%), Postives = 105/120 (87.50%), Query Frame = 0
BLAST of Carg27930 vs. TrEMBL
Match: tr|A0A1S4E2B7|A0A1S4E2B7_CUCME (nuclear inhibitor of protein phosphatase 1 OS=Cucumis melo OX=3656 GN=LOC103498201 PE=4 SV=1) HSP 1 Score: 168.3 bits (425), Expect = 1.0e-38 Identity = 93/120 (77.50%), Postives = 101/120 (84.17%), Query Frame = 0
BLAST of Carg27930 vs. TrEMBL
Match: tr|A0A2I4F8X5|A0A2I4F8X5_9ROSI (nuclear inhibitor of protein phosphatase 1 OS=Juglans regia OX=51240 GN=LOC108996573 PE=4 SV=1) HSP 1 Score: 144.1 bits (362), Expect = 2.1e-31 Identity = 79/120 (65.83%), Postives = 93/120 (77.50%), Query Frame = 0
BLAST of Carg27930 vs. TrEMBL
Match: tr|A0A2P5EXR1|A0A2P5EXR1_9ROSA (Serine/threonine protein kinase OS=Trema orientalis OX=63057 GN=TorRG33x02_139740 PE=4 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 1.4e-30 Identity = 75/120 (62.50%), Postives = 95/120 (79.17%), Query Frame = 0
BLAST of Carg27930 vs. TrEMBL
Match: tr|A0A2N9EWK5|A0A2N9EWK5_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS6913 PE=4 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 1.8e-30 Identity = 74/120 (61.67%), Postives = 91/120 (75.83%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: None |