Carg26879 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATAATCGTATTGGATGTGAATGGAAAACAACACAGTTACCTACCTGTTTTTCTAGTTGGAAGTGTCACTAATAACTTTCCTTTCAGGGGACAGGCATTGTGTACAACTGCTGCAGTCCTTGGAGGAAGGAGCTTGGCGTCACAAATCTCTGAGAAAATTGTATTCAACATTTGATTTGCTCTTTTTTCACGCTGAAGTATTAGTTACTTAGTGTTATTATTGTTGAACAGCGTAATTAAGTCATATTTTCGTTTCTCCTTTTCAGGTTGCTCTCTCAGGTGGGGTTCTGTTCATTGTTTTTGGAATCCAGTCGTTCCTCTCAACTGTCGAGCCGTAA ATGATAATCGTATTGGATGTGAATGGAAAACAACACAGTTACCTACCTGTTTTTCTAGTTGGAAGTGTCACTAATAACTTTCCTTTCAGGGGACAGGCATTGTGTACAACTGCTGCAGTCCTTGGAGGAAGGAGCTTGGCGTCACAAATCTCTGAGAAAATTGTTGCTCTCTCAGGTGGGGTTCTGTTCATTGTTTTTGGAATCCAGTCGTTCCTCTCAACTGTCGAGCCGTAA ATGATAATCGTATTGGATGTGAATGGAAAACAACACAGTTACCTACCTGTTTTTCTAGTTGGAAGTGTCACTAATAACTTTCCTTTCAGGGGACAGGCATTGTGTACAACTGCTGCAGTCCTTGGAGGAAGGAGCTTGGCGTCACAAATCTCTGAGAAAATTGTTGCTCTCTCAGGTGGGGTTCTGTTCATTGTTTTTGGAATCCAGTCGTTCCTCTCAACTGTCGAGCCGTAA MIIVLDVNGKQHSYLPVFLVGSVTNNFPFRGQALCTTAAVLGGRSLASQISEKIVALSGGVLFIVFGIQSFLSTVEP
BLAST of Carg26879 vs. NCBI nr
Match: XP_022938546.1 (GDT1-like protein 4 [Cucurbita moschata]) HSP 1 Score: 89.7 bits (221), Expect = 4.6e-15 Identity = 47/47 (100.00%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Carg26879 vs. NCBI nr
Match: XP_022994046.1 (GDT1-like protein 4 [Cucurbita maxima]) HSP 1 Score: 89.7 bits (221), Expect = 4.6e-15 Identity = 47/47 (100.00%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Carg26879 vs. NCBI nr
Match: XP_023551269.1 (GDT1-like protein 4 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 89.7 bits (221), Expect = 4.6e-15 Identity = 47/47 (100.00%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Carg26879 vs. NCBI nr
Match: XP_022964603.1 (GDT1-like protein 4 [Cucurbita moschata]) HSP 1 Score: 89.4 bits (220), Expect = 6.0e-15 Identity = 46/47 (97.87%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Carg26879 vs. NCBI nr
Match: XP_022971779.1 (GDT1-like protein 4 [Cucurbita maxima]) HSP 1 Score: 88.6 bits (218), Expect = 1.0e-14 Identity = 46/47 (97.87%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Carg26879 vs. TAIR10
Match: AT1G25520.1 (Uncharacterized protein family (UPF0016)) HSP 1 Score: 73.6 bits (179), Expect = 6.1e-14 Identity = 36/45 (80.00%), Postives = 44/45 (97.78%), Query Frame = 0
BLAST of Carg26879 vs. TAIR10
Match: AT1G68650.1 (Uncharacterized protein family (UPF0016)) HSP 1 Score: 72.0 bits (175), Expect = 1.8e-13 Identity = 36/45 (80.00%), Postives = 42/45 (93.33%), Query Frame = 0
BLAST of Carg26879 vs. TAIR10
Match: AT5G36290.1 (Uncharacterized protein family (UPF0016)) HSP 1 Score: 43.9 bits (102), Expect = 5.2e-05 Identity = 20/41 (48.78%), Postives = 30/41 (73.17%), Query Frame = 0
BLAST of Carg26879 vs. TAIR10
Match: AT4G13590.1 (Uncharacterized protein family (UPF0016)) HSP 1 Score: 39.7 bits (91), Expect = 9.8e-04 Identity = 19/41 (46.34%), Postives = 26/41 (63.41%), Query Frame = 0
BLAST of Carg26879 vs. Swiss-Prot
Match: sp|Q9C6M1|GDT14_ARATH (GDT1-like protein 4 OS=Arabidopsis thaliana OX=3702 GN=At1g25520 PE=2 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.1e-12 Identity = 36/45 (80.00%), Postives = 44/45 (97.78%), Query Frame = 0
BLAST of Carg26879 vs. Swiss-Prot
Match: sp|Q9SX28|GDT15_ARATH (GDT1-like protein 5 OS=Arabidopsis thaliana OX=3702 GN=At1g68650 PE=1 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 3.2e-12 Identity = 36/45 (80.00%), Postives = 42/45 (93.33%), Query Frame = 0
BLAST of Carg26879 vs. Swiss-Prot
Match: sp|B9G125|GDT15_ORYSJ (GDT1-like protein 5 OS=Oryza sativa subsp. japonica OX=39947 GN=Os08g0433100 PE=2 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 7.9e-11 Identity = 34/45 (75.56%), Postives = 40/45 (88.89%), Query Frame = 0
BLAST of Carg26879 vs. Swiss-Prot
Match: sp|A2ZE50|GDT13_ORYSI (GDT1-like protein 3 OS=Oryza sativa subsp. indica OX=39946 GN=OsI_36063 PE=3 SV=1) HSP 1 Score: 45.4 bits (106), Expect = 3.2e-04 Identity = 21/41 (51.22%), Postives = 30/41 (73.17%), Query Frame = 0
BLAST of Carg26879 vs. Swiss-Prot
Match: sp|Q2R4J1|GDT13_ORYSJ (GDT1-like protein 3 OS=Oryza sativa subsp. japonica OX=39947 GN=Os11g0472500 PE=2 SV=1) HSP 1 Score: 45.4 bits (106), Expect = 3.2e-04 Identity = 21/41 (51.22%), Postives = 30/41 (73.17%), Query Frame = 0
BLAST of Carg26879 vs. TrEMBL
Match: tr|A0A2I4FWF8|A0A2I4FWF8_9ROSI (GDT1-like protein 4 OS=Juglans regia OX=51240 GN=LOC109002607 PE=4 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 3.3e-14 Identity = 45/46 (97.83%), Postives = 46/46 (100.00%), Query Frame = 0
BLAST of Carg26879 vs. TrEMBL
Match: tr|M5XGN1|M5XGN1_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_1G306900 PE=4 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 5.7e-14 Identity = 45/46 (97.83%), Postives = 46/46 (100.00%), Query Frame = 0
BLAST of Carg26879 vs. TrEMBL
Match: tr|A0A1R3J5V0|A0A1R3J5V0_COCAP (Uncharacterized protein OS=Corchorus capsularis OX=210143 GN=CCACVL1_07457 PE=4 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 5.7e-14 Identity = 45/46 (97.83%), Postives = 46/46 (100.00%), Query Frame = 0
BLAST of Carg26879 vs. TrEMBL
Match: tr|A0A059BGF1|A0A059BGF1_EUCGR (Uncharacterized protein OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_G02342 PE=4 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 7.4e-14 Identity = 42/47 (89.36%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Carg26879 vs. TrEMBL
Match: tr|A0A059BFD1|A0A059BFD1_EUCGR (Uncharacterized protein OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_G02342 PE=4 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 7.4e-14 Identity = 42/47 (89.36%), Postives = 47/47 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|