Carg26499 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAACAATGAAGCTCTGCCTATTTCTCGTATTCGTCATATTCGTCTCGGCCATTGCTGCTCCACACTCTTTCGCCTTCTATGAGACATCTCTCACCCACGACAACTCCAAATATGGCTTCTTCGATGGAGACTCCACTTCAGCAACTGAAGATAGTCGACGACAACTTTTCCAATATGGAACCAACAATAAGTACTCTCGCAATAGATATTTGAGCTACTATTCATTGAGGCCGAGTAGTATCCTTTGTGGCCAACATGGTAGCTCGTACTATGATTGCAAGAAGCGTAAGAAGGTTAATCCGTATCATCGCAGTTGCACTGCCATCTCCAAATGCGCTCGAATTGCCGAATAA ATGGGAACAATGAAGCTCTGCCTATTTCTCGTATTCGTCATATTCGTCTCGGCCATTGCTGCTCCACACTCTTTCGCCTTCTATGAGACATCTCTCACCCACGACAACTCCAAATATGGCTTCTTCGATGGAGACTCCACTTCAGCAACTGAAGATAGTCGACGACAACTTTTCCAATATGGAACCAACAATAAGTACTCTCGCAATAGATATTTGAGCTACTATTCATTGAGGCCGAGTAGTATCCTTTGTGGCCAACATGGTAGCTCGTACTATGATTGCAAGAAGCGTAAGAAGGTTAATCCGTATCATCGCAGTTGCACTGCCATCTCCAAATGCGCTCGAATTGCCGAATAA ATGGGAACAATGAAGCTCTGCCTATTTCTCGTATTCGTCATATTCGTCTCGGCCATTGCTGCTCCACACTCTTTCGCCTTCTATGAGACATCTCTCACCCACGACAACTCCAAATATGGCTTCTTCGATGGAGACTCCACTTCAGCAACTGAAGATAGTCGACGACAACTTTTCCAATATGGAACCAACAATAAGTACTCTCGCAATAGATATTTGAGCTACTATTCATTGAGGCCGAGTAGTATCCTTTGTGGCCAACATGGTAGCTCGTACTATGATTGCAAGAAGCGTAAGAAGGTTAATCCGTATCATCGCAGTTGCACTGCCATCTCCAAATGCGCTCGAATTGCCGAATAA MGTMKLCLFLVFVIFVSAIAAPHSFAFYETSLTHDNSKYGFFDGDSTSATEDSRRQLFQYGTNNKYSRNRYLSYYSLRPSSILCGQHGSSYYDCKKRKKVNPYHRSCTAISKCARIAE
BLAST of Carg26499 vs. NCBI nr
Match: XP_022931602.1 (protein RALF-like 4 [Cucurbita moschata]) HSP 1 Score: 231.5 bits (589), Expect = 1.5e-57 Identity = 114/115 (99.13%), Postives = 115/115 (100.00%), Query Frame = 0
BLAST of Carg26499 vs. NCBI nr
Match: XP_022927737.1 (protein RALF-like 19 [Cucurbita moschata]) HSP 1 Score: 131.0 bits (328), Expect = 2.7e-27 Identity = 71/124 (57.26%), Postives = 90/124 (72.58%), Query Frame = 0
BLAST of Carg26499 vs. NCBI nr
Match: XP_022989015.1 (protein RALF-like 4 [Cucurbita maxima]) HSP 1 Score: 129.8 bits (325), Expect = 6.1e-27 Identity = 72/124 (58.06%), Postives = 89/124 (71.77%), Query Frame = 0
BLAST of Carg26499 vs. NCBI nr
Match: XP_022989014.1 (protein RALF-like 4 [Cucurbita maxima]) HSP 1 Score: 128.6 bits (322), Expect = 1.4e-26 Identity = 72/124 (58.06%), Postives = 88/124 (70.97%), Query Frame = 0
BLAST of Carg26499 vs. NCBI nr
Match: XP_022927734.1 (protein RALF-like 4 [Cucurbita moschata]) HSP 1 Score: 128.3 bits (321), Expect = 1.8e-26 Identity = 71/124 (57.26%), Postives = 92/124 (74.19%), Query Frame = 0
BLAST of Carg26499 vs. TAIR10
Match: AT2G33775.1 (ralf-like 19) HSP 1 Score: 62.0 bits (149), Expect = 2.8e-10 Identity = 30/66 (45.45%), Postives = 42/66 (63.64%), Query Frame = 0
BLAST of Carg26499 vs. TAIR10
Match: AT1G28270.1 (ralf-like 4) HSP 1 Score: 58.2 bits (139), Expect = 4.1e-09 Identity = 39/117 (33.33%), Postives = 62/117 (52.99%), Query Frame = 0
BLAST of Carg26499 vs. TAIR10
Match: AT3G16570.1 (rapid alkalinization factor 23) HSP 1 Score: 55.5 bits (132), Expect = 2.7e-08 Identity = 22/46 (47.83%), Postives = 35/46 (76.09%), Query Frame = 0
BLAST of Carg26499 vs. TAIR10
Match: AT4G15800.1 (ralf-like 33) HSP 1 Score: 53.9 bits (128), Expect = 7.7e-08 Identity = 20/46 (43.48%), Postives = 35/46 (76.09%), Query Frame = 0
BLAST of Carg26499 vs. TAIR10
Match: AT1G02900.1 (rapid alkalinization factor 1) HSP 1 Score: 51.6 bits (122), Expect = 3.8e-07 Identity = 19/44 (43.18%), Postives = 32/44 (72.73%), Query Frame = 0
BLAST of Carg26499 vs. Swiss-Prot
Match: sp|Q6NME6|RLF19_ARATH (Protein RALF-like 19 OS=Arabidopsis thaliana OX=3702 GN=RALFL19 PE=3 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 5.1e-09 Identity = 30/66 (45.45%), Postives = 42/66 (63.64%), Query Frame = 0
BLAST of Carg26499 vs. Swiss-Prot
Match: sp|Q9FZA0|RLF4_ARATH (Protein RALF-like 4 OS=Arabidopsis thaliana OX=3702 GN=RALFL4 PE=3 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 7.4e-08 Identity = 39/117 (33.33%), Postives = 62/117 (52.99%), Query Frame = 0
BLAST of Carg26499 vs. Swiss-Prot
Match: sp|Q9LUS7|RLF23_ARATH (Rapid alkalinization factor 23 OS=Arabidopsis thaliana OX=3702 GN=RALF23 PE=1 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 4.8e-07 Identity = 22/46 (47.83%), Postives = 35/46 (76.09%), Query Frame = 0
BLAST of Carg26499 vs. Swiss-Prot
Match: sp|Q8L9P8|RLF33_ARATH (Protein RALF-like 33 OS=Arabidopsis thaliana OX=3702 GN=RALFL33 PE=2 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 1.4e-06 Identity = 20/46 (43.48%), Postives = 35/46 (76.09%), Query Frame = 0
BLAST of Carg26499 vs. Swiss-Prot
Match: sp|Q9SRY3|RLF1_ARATH (Protein RALF-like 1 OS=Arabidopsis thaliana OX=3702 GN=RALF1 PE=1 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 6.9e-06 Identity = 19/44 (43.18%), Postives = 32/44 (72.73%), Query Frame = 0
BLAST of Carg26499 vs. TrEMBL
Match: tr|A0A0A0KHU4|A0A0A0KHU4_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G484570 PE=4 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 8.4e-17 Identity = 57/118 (48.31%), Postives = 71/118 (60.17%), Query Frame = 0
BLAST of Carg26499 vs. TrEMBL
Match: tr|A0A1S3B2H7|A0A1S3B2H7_CUCME (protein RALF-like 19 OS=Cucumis melo OX=3656 GN=LOC103485256 PE=4 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 7.1e-16 Identity = 56/118 (47.46%), Postives = 72/118 (61.02%), Query Frame = 0
BLAST of Carg26499 vs. TrEMBL
Match: tr|A0A1S4E1Z3|A0A1S4E1Z3_CUCME (protein RALF-like 4 OS=Cucumis melo OX=3656 GN=LOC107991607 PE=4 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 2.1e-15 Identity = 55/119 (46.22%), Postives = 73/119 (61.34%), Query Frame = 0
BLAST of Carg26499 vs. TrEMBL
Match: tr|A0A0A0KCD7|A0A0A0KCD7_CUCSA (F3H9.8 protein OS=Cucumis sativus OX=3659 GN=Csa_6G199790 PE=4 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 4.3e-13 Identity = 52/119 (43.70%), Postives = 69/119 (57.98%), Query Frame = 0
BLAST of Carg26499 vs. TrEMBL
Match: tr|C6SYC9|C6SYC9_SOYBN (Uncharacterized protein OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 3.2e-08 Identity = 31/73 (42.47%), Postives = 46/73 (63.01%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|