Carg26042 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGAAGATGGACTGTGATGGGTGTGAAAGGAGAATTAAAAATGCTGTTTCCTCCATCAAAGGTCTCCCCTTTCTACTCTTTGATTTATACGTGTTCTTACCTAATTGAGTTATGTTAAGCAATACTAAAAAGACACGAACGACGACTTAATTACAATGTATTACGACTCCTTTTCCCCTTGTTTGTTTGATATTTCACTGATTCCTGATAAGGAGTGAAGTCAGTGGAGGTGAACAGGAAGCAAAGCAAGGTAACAGTGATTGGATATGCTGAACCAAGCAAGGTTCTAAAAAGGGTTCAAAGCACAGGAAAGAAGGCTGAGTTTTGGCCTTATGTCCCCTACAACTTGGTGGCTTATCCTTATGTTGCTCAGGCTTACGACAAGAAGGCGCCTGCCGGGTACGTAAAGAACGCCACTCAAGCGCTCTCGGTTGCGGAGGCACCCGACGAGAGGTTGATAATGATGTTCAGCGATGAAAATCCTCATGCTTGTTCTATT ATGGTGAAGATGGACTGTGATGGGTGTGAAAGGAGAATTAAAAATGCTGTTTCCTCCATCAAAGGAGTGAAGTCAGTGGAGGTGAACAGGAAGCAAAGCAAGGTAACAGTGATTGGATATGCTGAACCAAGCAAGGTTCTAAAAAGGGTTCAAAGCACAGGAAAGAAGGCTGAGTTTTGGCCTTATGTCCCCTACAACTTGGTGGCTTATCCTTATGTTGCTCAGGCTTACGACAAGAAGGCGCCTGCCGGGTACGTAAAGAACGCCACTCAAGCGCTCTCGGTTGCGGAGGCACCCGACGAGAGGTTGATAATGATGTTCAGCGATGAAAATCCTCATGCTTGTTCTATT ATGGTGAAGATGGACTGTGATGGGTGTGAAAGGAGAATTAAAAATGCTGTTTCCTCCATCAAAGGAGTGAAGTCAGTGGAGGTGAACAGGAAGCAAAGCAAGGTAACAGTGATTGGATATGCTGAACCAAGCAAGGTTCTAAAAAGGGTTCAAAGCACAGGAAAGAAGGCTGAGTTTTGGCCTTATGTCCCCTACAACTTGGTGGCTTATCCTTATGTTGCTCAGGCTTACGACAAGAAGGCGCCTGCCGGGTACGTAAAGAACGCCACTCAAGCGCTCTCGGTTGCGGAGGCACCCGACGAGAGGTTGATAATGATGTTCAGCGATGAAAATCCTCATGCTTGTTCTATT MVKMDCDGCERRIKNAVSSIKGVKSVEVNRKQSKVTVIGYAEPSKVLKRVQSTGKKAEFWPYVPYNLVAYPYVAQAYDKKAPAGYVKNATQALSVAEAPDERLIMMFSDENPHACSI
BLAST of Carg26042 vs. NCBI nr
Match: XP_022989989.1 (heavy metal-associated isoprenylated plant protein 20-like [Cucurbita maxima]) HSP 1 Score: 233.8 bits (595), Expect = 3.0e-58 Identity = 116/117 (99.15%), Postives = 116/117 (99.15%), Query Frame = 0
BLAST of Carg26042 vs. NCBI nr
Match: XP_023520934.1 (heavy metal-associated isoprenylated plant protein 20-like isoform X1 [Cucurbita pepo subsp. pepo] >XP_023520935.1 heavy metal-associated isoprenylated plant protein 20-like isoform X2 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 233.8 bits (595), Expect = 3.0e-58 Identity = 116/117 (99.15%), Postives = 116/117 (99.15%), Query Frame = 0
BLAST of Carg26042 vs. NCBI nr
Match: XP_022963087.1 (heavy metal-associated isoprenylated plant protein 20-like [Cucurbita moschata]) HSP 1 Score: 233.4 bits (594), Expect = 3.9e-58 Identity = 116/117 (99.15%), Postives = 116/117 (99.15%), Query Frame = 0
BLAST of Carg26042 vs. NCBI nr
Match: XP_022152320.1 (heavy metal-associated isoprenylated plant protein 20-like [Momordica charantia]) HSP 1 Score: 210.3 bits (534), Expect = 3.5e-51 Identity = 99/116 (85.34%), Postives = 111/116 (95.69%), Query Frame = 0
BLAST of Carg26042 vs. NCBI nr
Match: XP_022993216.1 (heavy metal-associated isoprenylated plant protein 22-like [Cucurbita maxima]) HSP 1 Score: 209.1 bits (531), Expect = 7.9e-51 Identity = 101/116 (87.07%), Postives = 108/116 (93.10%), Query Frame = 0
BLAST of Carg26042 vs. TAIR10
Match: AT1G71050.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 169.1 bits (427), Expect = 1.6e-42 Identity = 81/118 (68.64%), Postives = 95/118 (80.51%), Query Frame = 0
BLAST of Carg26042 vs. TAIR10
Match: AT1G22990.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 164.9 bits (416), Expect = 3.1e-41 Identity = 79/117 (67.52%), Postives = 96/117 (82.05%), Query Frame = 0
BLAST of Carg26042 vs. TAIR10
Match: AT5G17450.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 162.5 bits (410), Expect = 1.5e-40 Identity = 74/117 (63.25%), Postives = 96/117 (82.05%), Query Frame = 0
BLAST of Carg26042 vs. TAIR10
Match: AT4G39700.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 155.6 bits (392), Expect = 1.9e-38 Identity = 75/120 (62.50%), Postives = 92/120 (76.67%), Query Frame = 0
BLAST of Carg26042 vs. TAIR10
Match: AT4G08570.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 136.0 bits (341), Expect = 1.5e-32 Identity = 64/118 (54.24%), Postives = 86/118 (72.88%), Query Frame = 0
BLAST of Carg26042 vs. Swiss-Prot
Match: sp|Q9C9A3|HIP20_ARATH (Heavy metal-associated isoprenylated plant protein 20 OS=Arabidopsis thaliana OX=3702 GN=HIPP20 PE=1 SV=1) HSP 1 Score: 169.1 bits (427), Expect = 2.9e-41 Identity = 81/118 (68.64%), Postives = 95/118 (80.51%), Query Frame = 0
BLAST of Carg26042 vs. Swiss-Prot
Match: sp|Q93VP2|HIP22_ARATH (Heavy metal-associated isoprenylated plant protein 22 OS=Arabidopsis thaliana OX=3702 GN=HIPP22 PE=1 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 5.6e-40 Identity = 79/117 (67.52%), Postives = 96/117 (82.05%), Query Frame = 0
BLAST of Carg26042 vs. Swiss-Prot
Match: sp|Q9LF57|HIP21_ARATH (Heavy metal-associated isoprenylated plant protein 21 OS=Arabidopsis thaliana OX=3702 GN=HIPP21 PE=1 SV=1) HSP 1 Score: 162.5 bits (410), Expect = 2.8e-39 Identity = 74/117 (63.25%), Postives = 96/117 (82.05%), Query Frame = 0
BLAST of Carg26042 vs. Swiss-Prot
Match: sp|O65657|HIP23_ARATH (Heavy metal-associated isoprenylated plant protein 23 OS=Arabidopsis thaliana OX=3702 GN=HIPP23 PE=1 SV=1) HSP 1 Score: 155.6 bits (392), Expect = 3.4e-37 Identity = 75/120 (62.50%), Postives = 92/120 (76.67%), Query Frame = 0
BLAST of Carg26042 vs. Swiss-Prot
Match: sp|O81464|HIP24_ARATH (Heavy metal-associated isoprenylated plant protein 24 OS=Arabidopsis thaliana OX=3702 GN=HIPP24 PE=1 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 2.8e-31 Identity = 64/118 (54.24%), Postives = 86/118 (72.88%), Query Frame = 0
BLAST of Carg26042 vs. TrEMBL
Match: tr|A0A067L0K9|A0A067L0K9_JATCU (Uncharacterized protein OS=Jatropha curcas OX=180498 GN=JCGZ_04678 PE=4 SV=1) HSP 1 Score: 197.6 bits (501), Expect = 1.6e-47 Identity = 94/116 (81.03%), Postives = 104/116 (89.66%), Query Frame = 0
BLAST of Carg26042 vs. TrEMBL
Match: tr|A0A1R3IZV5|A0A1R3IZV5_9ROSI (Uncharacterized protein OS=Corchorus olitorius OX=93759 GN=COLO4_20461 PE=4 SV=1) HSP 1 Score: 197.2 bits (500), Expect = 2.0e-47 Identity = 92/116 (79.31%), Postives = 105/116 (90.52%), Query Frame = 0
BLAST of Carg26042 vs. TrEMBL
Match: tr|A0A2P5FK73|A0A2P5FK73_9ROSA (Heavy metal-associated domain containing protein OS=Trema orientalis OX=63057 GN=TorRG33x02_060250 PE=4 SV=1) HSP 1 Score: 196.8 bits (499), Expect = 2.7e-47 Identity = 93/116 (80.17%), Postives = 103/116 (88.79%), Query Frame = 0
BLAST of Carg26042 vs. TrEMBL
Match: tr|A0A2I4E609|A0A2I4E609_9ROSI (heavy metal-associated isoprenylated plant protein 20-like OS=Juglans regia OX=51240 GN=LOC108986619 PE=4 SV=1) HSP 1 Score: 196.8 bits (499), Expect = 2.7e-47 Identity = 91/116 (78.45%), Postives = 104/116 (89.66%), Query Frame = 0
BLAST of Carg26042 vs. TrEMBL
Match: tr|B9SYJ6|B9SYJ6_RICCO (Metal ion binding protein, putative OS=Ricinus communis OX=3988 GN=RCOM_1288720 PE=4 SV=1) HSP 1 Score: 196.8 bits (499), Expect = 2.7e-47 Identity = 94/116 (81.03%), Postives = 104/116 (89.66%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: None |