Carg25839 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATCCACGAATCTGTTGCAACAGCGCATGGATCAATCTTATTTCAGAGCCAAAGGAGTGGGAAAATTCACTTGCCTGTATTGGGGAAACAACTGCAGCAGTAGCAAAAAGATTAGGATTGAAAAACGTTTACTACCCGAAGAATCCTGGTCTTGAAGGGTGAGTTTTTCCATACTTCTACCTTACAATTTAGTAGTTGAGTTCCTGGTAACCACCTACCTAGAAATTTTTTAGCAACTAAATCTAGTAGGGTCGGACTATTATACTTTAGATTAGTCGAGATGCACCTAAGCTGATTCAGACACTCACGGATATAATAATTAATAATAAATATAACAATAAGATCAAATAGACTAAATGTGAATTTACAAACGTGATAATTGAAATGCAGGTGGGTTGATAGTATATTGGAAGCAGTAAGAGCAGAAGCACAGGTCGTTTAGGACATTGTCCAGACTAGGAAGTCATCTTTACTTCTTTTCCAGAGTTGCAGACGGAGACGGAACAAAGCATTCAACCATTGTATCATCACATGGCATGATCACAGTCGATATGCCCGAGTTTCTATTCGAGGTTAGTCACTTTTCCAGTAGTTTTACGTTCATTTATCTGTCTGTCCAGTTCGATATCAGATAA ATGGATCCACGAATCTGTTGCAACAGCGCATGGATCAATCTTATTTCAGAGCCAAAGGAGTGGGAAAATTCACTTGCCTGTATTGGGGAAACAACTGCAGCAGTAGCAAAAAGATTAGGATTGAAAAACGTTTACTACCCGAAGAATCCTGGTCTTGAAGGAGTTGCAGACGGAGACGGAACAAAGCATTCAACCATTGTATCATCACATGGCATGATCACAGTCGATATGCCCGAGTTTCTATTCGAGTTCGATATCAGATAA ATGGATCCACGAATCTGTTGCAACAGCGCATGGATCAATCTTATTTCAGAGCCAAAGGAGTGGGAAAATTCACTTGCCTGTATTGGGGAAACAACTGCAGCAGTAGCAAAAAGATTAGGATTGAAAAACGTTTACTACCCGAAGAATCCTGGTCTTGAAGGAGTTGCAGACGGAGACGGAACAAAGCATTCAACCATTGTATCATCACATGGCATGATCACAGTCGATATGCCCGAGTTTCTATTCGAGTTCGATATCAGATAA MDPRICCNSAWINLISEPKEWENSLACIGETTAAVAKRLGLKNVYYPKNPGLEGVADGDGTKHSTIVSSHGMITVDMPEFLFEFDIR
BLAST of Carg25839 vs. NCBI nr
Match: XP_022951382.1 (uroporphyrinogen-III synthase, chloroplastic [Cucurbita moschata]) HSP 1 Score: 100.5 bits (249), Expect = 2.9e-18 Identity = 46/48 (95.83%), Postives = 46/48 (95.83%), Query Frame = 0
BLAST of Carg25839 vs. NCBI nr
Match: XP_023002006.1 (uroporphyrinogen-III synthase, chloroplastic-like [Cucurbita maxima]) HSP 1 Score: 99.0 bits (245), Expect = 8.5e-18 Identity = 45/48 (93.75%), Postives = 46/48 (95.83%), Query Frame = 0
BLAST of Carg25839 vs. NCBI nr
Match: XP_023537362.1 (uroporphyrinogen-III synthase, chloroplastic isoform X2 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 97.1 bits (240), Expect = 3.2e-17 Identity = 45/48 (93.75%), Postives = 45/48 (93.75%), Query Frame = 0
BLAST of Carg25839 vs. NCBI nr
Match: XP_023537361.1 (uroporphyrinogen-III synthase, chloroplastic isoform X1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 97.1 bits (240), Expect = 3.2e-17 Identity = 45/48 (93.75%), Postives = 45/48 (93.75%), Query Frame = 0
BLAST of Carg25839 vs. NCBI nr
Match: XP_022962039.1 (uroporphyrinogen-III synthase, chloroplastic-like [Cucurbita moschata] >XP_022962040.1 uroporphyrinogen-III synthase, chloroplastic-like [Cucurbita moschata]) HSP 1 Score: 95.9 bits (237), Expect = 7.2e-17 Identity = 42/48 (87.50%), Postives = 44/48 (91.67%), Query Frame = 0
BLAST of Carg25839 vs. TAIR10
Match: AT2G26540.1 (uroporphyrinogen-III synthase family protein) HSP 1 Score: 74.3 bits (181), Expect = 4.1e-14 Identity = 30/45 (66.67%), Postives = 38/45 (84.44%), Query Frame = 0
BLAST of Carg25839 vs. Swiss-Prot
Match: sp|O48721|HEM4_ARATH (Uroporphyrinogen-III synthase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=UROS PE=2 SV=2) HSP 1 Score: 74.3 bits (181), Expect = 7.3e-13 Identity = 30/45 (66.67%), Postives = 38/45 (84.44%), Query Frame = 0
BLAST of Carg25839 vs. Swiss-Prot
Match: sp|Q10QR9|HEM4_ORYSJ (Uroporphyrinogen-III synthase, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=UROS PE=2 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 1.8e-11 Identity = 27/45 (60.00%), Postives = 36/45 (80.00%), Query Frame = 0
BLAST of Carg25839 vs. TrEMBL
Match: tr|A0A0A0LLB2|A0A0A0LLB2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G360600 PE=4 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 6.9e-16 Identity = 40/48 (83.33%), Postives = 43/48 (89.58%), Query Frame = 0
BLAST of Carg25839 vs. TrEMBL
Match: tr|A0A1S3BBN0|A0A1S3BBN0_CUCME (uroporphyrinogen-III synthase, chloroplastic OS=Cucumis melo OX=3656 GN=LOC103487917 PE=4 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 2.6e-15 Identity = 39/48 (81.25%), Postives = 42/48 (87.50%), Query Frame = 0
BLAST of Carg25839 vs. TrEMBL
Match: tr|M0S608|M0S608_MUSAM (Uncharacterized protein OS=Musa acuminata subsp. malaccensis OX=214687 GN=103976089 PE=4 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 8.4e-14 Identity = 36/48 (75.00%), Postives = 40/48 (83.33%), Query Frame = 0
BLAST of Carg25839 vs. TrEMBL
Match: tr|W9RIJ9|W9RIJ9_9ROSA (Uroporphyrinogen-III synthase OS=Morus notabilis OX=981085 GN=L484_026091 PE=4 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 1.9e-13 Identity = 34/48 (70.83%), Postives = 42/48 (87.50%), Query Frame = 0
BLAST of Carg25839 vs. TrEMBL
Match: tr|A0A2H5NH05|A0A2H5NH05_CITUN (Uncharacterized protein OS=Citrus unshiu OX=55188 GN=CUMW_044530 PE=4 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 2.4e-13 Identity = 35/49 (71.43%), Postives = 43/49 (87.76%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|