Carg25262 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGAAGTAGAATTGCTGGAAATGTTTACAAACCGAGAGCTGGAAGAAGGAGCCATTGGTTCGTCTGATTGGAATCCAACTGATGCTGTGCTGTTCGTTGGACTGAGTTTGGTGCTTGGAATCGCTTGTAGACACTTACTGCGAGGCACCAGAGTTCCTTATACAGTTGCCTTGCTTGTTCTTGGCATAATTCTTGGATCCATTGGTTGGTGA ATGGCGGAAGTAGAATTGCTGGAAATGTTTACAAACCGAGAGCTGGAAGAAGGAGCCATTGGTTCGTCTGATTGGAATCCAACTGATGCTGTGCTGTTCGTTGGACTGAGTTTGGTGCTTGGAATCGCTTGTAGACACTTACTGCGAGGCACCAGAGTTCCTTATACAGTTGCCTTGCTTGTTCTTGGCATAATTCTTGGATCCATTGGTTGGTGA ATGGCGGAAGTAGAATTGCTGGAAATGTTTACAAACCGAGAGCTGGAAGAAGGAGCCATTGGTTCGTCTGATTGGAATCCAACTGATGCTGTGCTGTTCGTTGGACTGAGTTTGGTGCTTGGAATCGCTTGTAGACACTTACTGCGAGGCACCAGAGTTCCTTATACAGTTGCCTTGCTTGTTCTTGGCATAATTCTTGGATCCATTGGTTGGTGA MAEVELLEMFTNRELEEGAIGSSDWNPTDAVLFVGLSLVLGIACRHLLRGTRVPYTVALLVLGIILGSIGW
BLAST of Carg25262 vs. NCBI nr
Match: XP_022955949.1 (sodium/hydrogen exchanger 8 isoform X1 [Cucurbita moschata]) HSP 1 Score: 136.3 bits (342), Expect = 3.9e-29 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 0
BLAST of Carg25262 vs. NCBI nr
Match: XP_022989835.1 (sodium/hydrogen exchanger 8 isoform X1 [Cucurbita maxima]) HSP 1 Score: 136.3 bits (342), Expect = 3.9e-29 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 0
BLAST of Carg25262 vs. NCBI nr
Match: XP_023525783.1 (sodium/hydrogen exchanger 8 isoform X1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 136.3 bits (342), Expect = 3.9e-29 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 0
BLAST of Carg25262 vs. NCBI nr
Match: XP_022146360.1 (sodium/hydrogen exchanger 8-like isoform X1 [Momordica charantia]) HSP 1 Score: 123.6 bits (309), Expect = 2.6e-25 Identity = 61/69 (88.41%), Postives = 66/69 (95.65%), Query Frame = 0
BLAST of Carg25262 vs. NCBI nr
Match: XP_022146361.1 (sodium/hydrogen exchanger 8-like isoform X2 [Momordica charantia]) HSP 1 Score: 123.6 bits (309), Expect = 2.6e-25 Identity = 61/69 (88.41%), Postives = 66/69 (95.65%), Query Frame = 0
BLAST of Carg25262 vs. TAIR10
Match: AT2G01980.1 (sodium proton exchanger, putative (NHX7) (SOS1)) HSP 1 Score: 75.1 bits (183), Expect = 1.9e-14 Identity = 37/44 (84.09%), Postives = 41/44 (93.18%), Query Frame = 0
BLAST of Carg25262 vs. TAIR10
Match: AT1G14660.1 (Na+/H+ exchanger 8) HSP 1 Score: 68.9 bits (167), Expect = 1.4e-12 Identity = 37/59 (62.71%), Postives = 42/59 (71.19%), Query Frame = 0
BLAST of Carg25262 vs. Swiss-Prot
Match: sp|Q9LKW9|NHX7_ARATH (Sodium/hydrogen exchanger 7 OS=Arabidopsis thaliana OX=3702 GN=NHX7 PE=1 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 3.5e-13 Identity = 37/44 (84.09%), Postives = 41/44 (93.18%), Query Frame = 0
BLAST of Carg25262 vs. Swiss-Prot
Match: sp|Q3YL57|NHX8_ARATH (Sodium/hydrogen exchanger 8 OS=Arabidopsis thaliana OX=3702 GN=NHX8 PE=2 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 2.5e-11 Identity = 37/59 (62.71%), Postives = 42/59 (71.19%), Query Frame = 0
BLAST of Carg25262 vs. TrEMBL
Match: tr|A0A1S3CS69|A0A1S3CS69_CUCME (sodium/hydrogen exchanger 8 OS=Cucumis melo OX=3656 GN=LOC103504147 PE=4 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 3.0e-25 Identity = 61/69 (88.41%), Postives = 66/69 (95.65%), Query Frame = 0
BLAST of Carg25262 vs. TrEMBL
Match: tr|A0A0A0KJ31|A0A0A0KJ31_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G098980 PE=4 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 1.5e-24 Identity = 60/69 (86.96%), Postives = 64/69 (92.75%), Query Frame = 0
BLAST of Carg25262 vs. TrEMBL
Match: tr|H9DVC6|H9DVC6_CUCSA (Plasmalemma Na+/H+ antiporter OS=Cucumis sativus OX=3659 GN=sos1 PE=2 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 1.5e-24 Identity = 60/69 (86.96%), Postives = 64/69 (92.75%), Query Frame = 0
BLAST of Carg25262 vs. TrEMBL
Match: tr|U5G5K6|U5G5K6_POPTR (SOS1-like protein 1 OS=Populus trichocarpa OX=3694 GN=POPTR_008G140700v3 PE=2 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 5.3e-14 Identity = 40/48 (83.33%), Postives = 44/48 (91.67%), Query Frame = 0
BLAST of Carg25262 vs. TrEMBL
Match: tr|A0A067DM57|A0A067DM57_CITSI (Uncharacterized protein (Fragment) OS=Citrus sinensis OX=2711 GN=CISIN_1g0011162mg PE=4 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 5.3e-14 Identity = 44/62 (70.97%), Postives = 50/62 (80.65%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|