Carg23978 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAAGAGCTCCATGTTGTGACAAAGCCAATGTAAAGAAAGGTCCTTGGTCCCCTGATGAGGATGCCACTCTCAAACTCTATGTGGAAACTCATGGCACTGCAGGCACCTGGATTGCTCTGCCCACAAAAGCTGGTGAACTCTCTTTCTTGTTTCCAACTTGAATTACCACCATTTATGTTTGATATCTCTCTGTTATGTATTATAAACTGCAGGGCTAAAGAGATGTGGCAAGAGCTGCAGGTTACGGTGGCTAAACTATCTTAGACCCAACATCAAGCATGGAGACTTTACAGAGGATGAAGACAATCTCATCTTTAATCTCTATAATCAATATGGAAGCAGGCAAGTTTGGTAG ATGGGAAGAGCTCCATGTTGTGACAAAGCCAATGTAAAGAAAGGTCCTTGGTCCCCTGATGAGGATGCCACTCTCAAACTCTATGTGGAAACTCATGGCACTGCAGGCACCTGGATTGCTCTGCCCACAAAAGCTGGGCTAAAGAGATGTGGCAAGAGCTGCAGGTTACGGTGGCTAAACTATCTTAGACCCAACATCAAGCATGGAGACTTTACAGAGGATGAAGACAATCTCATCTTTAATCTCTATAATCAATATGGAAGCAGGCAAGTTTGGTAG ATGGGAAGAGCTCCATGTTGTGACAAAGCCAATGTAAAGAAAGGTCCTTGGTCCCCTGATGAGGATGCCACTCTCAAACTCTATGTGGAAACTCATGGCACTGCAGGCACCTGGATTGCTCTGCCCACAAAAGCTGGGCTAAAGAGATGTGGCAAGAGCTGCAGGTTACGGTGGCTAAACTATCTTAGACCCAACATCAAGCATGGAGACTTTACAGAGGATGAAGACAATCTCATCTTTAATCTCTATAATCAATATGGAAGCAGGCAAGTTTGGTAG MGRAPCCDKANVKKGPWSPDEDATLKLYVETHGTAGTWIALPTKAGLKRCGKSCRLRWLNYLRPNIKHGDFTEDEDNLIFNLYNQYGSRQVW
BLAST of Carg23978 vs. NCBI nr
Match: XP_022951223.1 (transcription factor MYB36-like [Cucurbita moschata]) HSP 1 Score: 200.7 bits (509), Expect = 2.2e-48 Identity = 89/89 (100.00%), Postives = 89/89 (100.00%), Query Frame = 0
BLAST of Carg23978 vs. NCBI nr
Match: XP_023537883.1 (transcription factor MYB36-like isoform X1 [Cucurbita pepo subsp. pepo] >XP_023537884.1 transcription factor MYB36-like isoform X2 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 199.1 bits (505), Expect = 6.4e-48 Identity = 88/89 (98.88%), Postives = 89/89 (100.00%), Query Frame = 0
BLAST of Carg23978 vs. NCBI nr
Match: XP_023002574.1 (transcription factor MYB36-like [Cucurbita maxima]) HSP 1 Score: 198.7 bits (504), Expect = 8.3e-48 Identity = 88/89 (98.88%), Postives = 89/89 (100.00%), Query Frame = 0
BLAST of Carg23978 vs. NCBI nr
Match: XP_008444504.1 (PREDICTED: transcription factor RAX3-like [Cucumis melo]) HSP 1 Score: 184.1 bits (466), Expect = 2.1e-43 Identity = 80/89 (89.89%), Postives = 84/89 (94.38%), Query Frame = 0
BLAST of Carg23978 vs. NCBI nr
Match: XP_004142913.1 (PREDICTED: transcription factor RAX3 [Cucumis sativus] >KGN62411.1 hypothetical protein Csa_2G352410 [Cucumis sativus]) HSP 1 Score: 182.6 bits (462), Expect = 6.2e-43 Identity = 79/89 (88.76%), Postives = 84/89 (94.38%), Query Frame = 0
BLAST of Carg23978 vs. TAIR10
Match: AT2G36890.1 (Duplicated homeodomain-like superfamily protein) HSP 1 Score: 163.3 bits (412), Expect = 7.0e-41 Identity = 69/89 (77.53%), Postives = 79/89 (88.76%), Query Frame = 0
BLAST of Carg23978 vs. TAIR10
Match: AT5G65790.1 (myb domain protein 68) HSP 1 Score: 160.6 bits (405), Expect = 4.6e-40 Identity = 70/89 (78.65%), Postives = 76/89 (85.39%), Query Frame = 0
BLAST of Carg23978 vs. TAIR10
Match: AT3G49690.1 (myb domain protein 84) HSP 1 Score: 159.1 bits (401), Expect = 1.3e-39 Identity = 69/89 (77.53%), Postives = 76/89 (85.39%), Query Frame = 0
BLAST of Carg23978 vs. TAIR10
Match: AT5G57620.1 (myb domain protein 36) HSP 1 Score: 156.8 bits (395), Expect = 6.6e-39 Identity = 67/89 (75.28%), Postives = 75/89 (84.27%), Query Frame = 0
BLAST of Carg23978 vs. TAIR10
Match: AT5G23000.1 (myb domain protein 37) HSP 1 Score: 151.8 bits (382), Expect = 2.1e-37 Identity = 62/89 (69.66%), Postives = 75/89 (84.27%), Query Frame = 0
BLAST of Carg23978 vs. Swiss-Prot
Match: sp|Q9SJL7|RAX2_ARATH (Transcription factor RAX2 OS=Arabidopsis thaliana OX=3702 GN=RAX2 PE=1 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 1.3e-39 Identity = 69/89 (77.53%), Postives = 79/89 (88.76%), Query Frame = 0
BLAST of Carg23978 vs. Swiss-Prot
Match: sp|Q9M2Y9|RAX3_ARATH (Transcription factor RAX3 OS=Arabidopsis thaliana OX=3702 GN=RAX3 PE=2 SV=1) HSP 1 Score: 159.1 bits (401), Expect = 2.4e-38 Identity = 69/89 (77.53%), Postives = 76/89 (85.39%), Query Frame = 0
BLAST of Carg23978 vs. Swiss-Prot
Match: sp|Q9FKL2|MYB36_ARATH (Transcription factor MYB36 OS=Arabidopsis thaliana OX=3702 GN=MYB36 PE=1 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 1.2e-37 Identity = 67/89 (75.28%), Postives = 75/89 (84.27%), Query Frame = 0
BLAST of Carg23978 vs. Swiss-Prot
Match: sp|Q9FG68|RAX1_ARATH (Transcription factor RAX1 OS=Arabidopsis thaliana OX=3702 GN=RAX1 PE=1 SV=1) HSP 1 Score: 151.8 bits (382), Expect = 3.8e-36 Identity = 62/89 (69.66%), Postives = 75/89 (84.27%), Query Frame = 0
BLAST of Carg23978 vs. Swiss-Prot
Match: sp|F4JSU0|MYB87_ARATH (Transcription factor MYB87 OS=Arabidopsis thaliana OX=3702 GN=MYB87 PE=2 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 9.4e-35 Identity = 62/89 (69.66%), Postives = 72/89 (80.90%), Query Frame = 0
BLAST of Carg23978 vs. TrEMBL
Match: tr|A0A1S3BB79|A0A1S3BB79_CUCME (transcription factor RAX3-like OS=Cucumis melo OX=3656 GN=LOC103487802 PE=4 SV=1) HSP 1 Score: 184.1 bits (466), Expect = 1.4e-43 Identity = 80/89 (89.89%), Postives = 84/89 (94.38%), Query Frame = 0
BLAST of Carg23978 vs. TrEMBL
Match: tr|A0A0A0LR01|A0A0A0LR01_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G352410 PE=4 SV=1) HSP 1 Score: 182.6 bits (462), Expect = 4.1e-43 Identity = 79/89 (88.76%), Postives = 84/89 (94.38%), Query Frame = 0
BLAST of Carg23978 vs. TrEMBL
Match: tr|A0A2P5DTP6|A0A2P5DTP6_PARAD (Octamer-binding transcription factor OS=Parasponia andersonii OX=3476 GN=PanWU01x14_033380 PE=4 SV=1) HSP 1 Score: 177.6 bits (449), Expect = 1.3e-41 Identity = 76/92 (82.61%), Postives = 85/92 (92.39%), Query Frame = 0
BLAST of Carg23978 vs. TrEMBL
Match: tr|A0A2P5EKV3|A0A2P5EKV3_9ROSA (Octamer-binding transcription factor OS=Trema orientalis OX=63057 GN=TorRG33x02_180720 PE=4 SV=1) HSP 1 Score: 176.8 bits (447), Expect = 2.2e-41 Identity = 76/91 (83.52%), Postives = 84/91 (92.31%), Query Frame = 0
BLAST of Carg23978 vs. TrEMBL
Match: tr|A0A0L9V197|A0A0L9V197_PHAAN (Uncharacterized protein OS=Phaseolus angularis OX=3914 GN=LR48_Vigan07g260400 PE=4 SV=1) HSP 1 Score: 176.0 bits (445), Expect = 3.8e-41 Identity = 76/91 (83.52%), Postives = 83/91 (91.21%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|