Carg23892 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.GATGCGAAGATTTGCTTTTATGATGATATACTACCAGACGGATTCAGTGTGAGAAAAGGAGATATGGTGTCATACCAACCATATGCAATGGGTAGGATGAAGTTCATATGGGGTGACGACGCCGAGGAGTTCCGACCCGAGCGATGGTTCGACCGAGATGGAAAGCTTCAGCCTCAGAGCCCTTTCAAATTCACAGCCTTTCAGGTATGTACTAATACAATTGAAACGAAATGGTTTGCTGCGGAGAAAGTGCATAATAGTATTTTTTATAAGACTGATGGTTCACAGGCAGGGCCACGCATAGAATTCGGACCCCTAGTATACAAGAAAATTATACATTTTAATATGAAGTTAAGAGGAAAACCTAGCGAGCATCGGGGCTCGACTCGGGGCTCGGATCTCCTTCCACCCCACGCGTTTGTATGGGGCTGAGTGTCCATTGATGTATATGATACAGGCTATGATTTTATAAAGGGGTTAAGTGTCACGGTCATGCTTGTTCAAGGCGGGTTGCTTGTGGCTCTGTATTGAATGTTGCAGTCATACTTGTCTAGGGCGCGTTGTTCATGGTTGTATGCCCGTTCCAAACTCCTTTTATTTGCTTTCATGTGTAACTAGGTTTTTACTATTCTTGTCATGTCAATATGGGGGTATGATTGTTCACCATAATTATGTCTATACCCGTCATGACTAAAATGTCTCAAAATGTACTATTATTTAACATTTATAATGGTCTAGCCATCCCCCGTTTCCAAAAAGGGGATGTAGCTCACATGTGGACGCTCGTTGATGCGGATCGTACTTGAGTTTCCCGACTCCAGTCTTTTTTACTTAGGTTTTTACACCGCATCGAATGTGCAAAGCTTCATCACCATTCCGGAGTCTCAGAGCCTCTCATCTCGCAAATTCGCCGTCGTTCTCTTCCGGGCGCGAGGTGATGACGTACTGGAACAACGTTGA GATGCGAAGATTTGCTTTTATGATGATATACTACCAGACGGATTCAGTGTGAGAAAAGGAGATATGGTGTCATACCAACCATATGCAATGGGTAGGATGAAGTTCATATGGGGTGACGACGCCGAGGAGTTCCGACCCGAGCGATGGTTCGACCGAGATGGAAAGCTTCAGCCTCAGAGCCCTTTCAAATTCACAGCCTTTCAGGTATGTTTTTACACCGCATCGAATGTGCAAAGCTTCATCACCATTCCGGAGTCTCAGAGCCTCTCATCTCGCAAATTCGCCGTCGTTCTCTTCCGGGCGCGAGGTGATGACGTACTGGAACAACGTTGA GATGCGAAGATTTGCTTTTATGATGATATACTACCAGACGGATTCAGTGTGAGAAAAGGAGATATGGTGTCATACCAACCATATGCAATGGGTAGGATGAAGTTCATATGGGGTGACGACGCCGAGGAGTTCCGACCCGAGCGATGGTTCGACCGAGATGGAAAGCTTCAGCCTCAGAGCCCTTTCAAATTCACAGCCTTTCAGGTATGTTTTTACACCGCATCGAATGTGCAAAGCTTCATCACCATTCCGGAGTCTCAGAGCCTCTCATCTCGCAAATTCGCCGTCGTTCTCTTCCGGGCGCGAGGTGATGACGTACTGGAACAACGTTGA DAKICFYDDILPDGFSVRKGDMVSYQPYAMGRMKFIWGDDAEEFRPERWFDRDGKLQPQSPFKFTAFQVCFYTASNVQSFITIPESQSLSSRKFAVVLFRARGDDVLEQR
BLAST of Carg23892 vs. NCBI nr
Match: XP_008438128.1 (PREDICTED: cytochrome P450 704C1-like [Cucumis melo]) HSP 1 Score: 139.8 bits (351), Expect = 5.5e-30 Identity = 62/68 (91.18%), Postives = 63/68 (92.65%), Query Frame = 0
BLAST of Carg23892 vs. NCBI nr
Match: XP_017978005.1 (PREDICTED: cytochrome P450 704C1 isoform X1 [Theobroma cacao]) HSP 1 Score: 138.7 bits (348), Expect = 1.2e-29 Identity = 61/70 (87.14%), Postives = 62/70 (88.57%), Query Frame = 0
BLAST of Carg23892 vs. NCBI nr
Match: XP_017978011.1 (PREDICTED: cytochrome P450 704C1 isoform X2 [Theobroma cacao]) HSP 1 Score: 138.7 bits (348), Expect = 1.2e-29 Identity = 61/70 (87.14%), Postives = 62/70 (88.57%), Query Frame = 0
BLAST of Carg23892 vs. NCBI nr
Match: XP_017978024.1 (PREDICTED: cytochrome P450 704C1 isoform X5 [Theobroma cacao]) HSP 1 Score: 138.7 bits (348), Expect = 1.2e-29 Identity = 61/70 (87.14%), Postives = 62/70 (88.57%), Query Frame = 0
BLAST of Carg23892 vs. NCBI nr
Match: XP_022924418.1 (cytochrome P450 704C1 isoform X2 [Cucurbita moschata]) HSP 1 Score: 138.7 bits (348), Expect = 1.2e-29 Identity = 62/68 (91.18%), Postives = 63/68 (92.65%), Query Frame = 0
BLAST of Carg23892 vs. TAIR10
Match: AT2G45510.1 (cytochrome P450, family 704, subfamily A, polypeptide 2) HSP 1 Score: 89.7 bits (221), Expect = 1.2e-18 Identity = 40/67 (59.70%), Postives = 48/67 (71.64%), Query Frame = 0
BLAST of Carg23892 vs. TAIR10
Match: AT2G44890.1 (cytochrome P450, family 704, subfamily A, polypeptide 1) HSP 1 Score: 85.9 bits (211), Expect = 1.7e-17 Identity = 38/60 (63.33%), Postives = 45/60 (75.00%), Query Frame = 0
BLAST of Carg23892 vs. TAIR10
Match: AT2G27690.1 (cytochrome P450, family 94, subfamily C, polypeptide 1) HSP 1 Score: 85.5 bits (210), Expect = 2.2e-17 Identity = 36/68 (52.94%), Postives = 45/68 (66.18%), Query Frame = 0
BLAST of Carg23892 vs. TAIR10
Match: AT1G69500.1 (cytochrome P450, family 704, subfamily B, polypeptide 1) HSP 1 Score: 84.0 bits (206), Expect = 6.5e-17 Identity = 39/68 (57.35%), Postives = 48/68 (70.59%), Query Frame = 0
BLAST of Carg23892 vs. TAIR10
Match: AT3G48520.1 (cytochrome P450, family 94, subfamily B, polypeptide 3) HSP 1 Score: 84.0 bits (206), Expect = 6.5e-17 Identity = 38/73 (52.05%), Postives = 49/73 (67.12%), Query Frame = 0
BLAST of Carg23892 vs. Swiss-Prot
Match: sp|Q50EK3|C04C1_PINTA (Cytochrome P450 704C1 OS=Pinus taeda OX=3352 GN=CYP704C1 PE=2 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 1.3e-19 Identity = 42/68 (61.76%), Postives = 52/68 (76.47%), Query Frame = 0
BLAST of Carg23892 vs. Swiss-Prot
Match: sp|Q9ZUX1|C94C1_ARATH (Cytochrome P450 94C1 OS=Arabidopsis thaliana OX=3702 GN=CYP94C1 PE=1 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 4.0e-16 Identity = 36/68 (52.94%), Postives = 45/68 (66.18%), Query Frame = 0
BLAST of Carg23892 vs. Swiss-Prot
Match: sp|Q9C788|C70B1_ARATH (Cytochrome P450 704B1 OS=Arabidopsis thaliana OX=3702 GN=CYP704B1 PE=1 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 1.2e-15 Identity = 39/68 (57.35%), Postives = 48/68 (70.59%), Query Frame = 0
BLAST of Carg23892 vs. Swiss-Prot
Match: sp|Q9SMP5|C94B3_ARATH (Cytochrome P450 94B3 OS=Arabidopsis thaliana OX=3702 GN=CYP94B3 PE=1 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 1.2e-15 Identity = 38/73 (52.05%), Postives = 49/73 (67.12%), Query Frame = 0
BLAST of Carg23892 vs. Swiss-Prot
Match: sp|P85191|CP450_HELAN (Cytochrome P450 (Fragment) OS=Helianthus annuus OX=4232 PE=1 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 9.9e-15 Identity = 34/68 (50.00%), Postives = 49/68 (72.06%), Query Frame = 0
BLAST of Carg23892 vs. TrEMBL
Match: tr|A0A1S3AW87|A0A1S3AW87_CUCME (cytochrome P450 704C1-like OS=Cucumis melo OX=3656 GN=LOC103483328 PE=4 SV=1) HSP 1 Score: 139.8 bits (351), Expect = 3.6e-30 Identity = 62/68 (91.18%), Postives = 63/68 (92.65%), Query Frame = 0
BLAST of Carg23892 vs. TrEMBL
Match: tr|A0A0A0L912|A0A0A0L912_CUCSA (Cytochrome P450 OS=Cucumis sativus OX=3659 GN=Csa_3G124940 PE=4 SV=1) HSP 1 Score: 137.5 bits (345), Expect = 1.8e-29 Identity = 62/68 (91.18%), Postives = 62/68 (91.18%), Query Frame = 0
BLAST of Carg23892 vs. TrEMBL
Match: tr|A0A061DTU0|A0A061DTU0_THECC (Cytochrome P450 family protein OS=Theobroma cacao OX=3641 GN=TCM_046700 PE=4 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 2.6e-28 Identity = 59/68 (86.76%), Postives = 60/68 (88.24%), Query Frame = 0
BLAST of Carg23892 vs. TrEMBL
Match: tr|A0A059CJ75|A0A059CJ75_EUCGR (Uncharacterized protein OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_D02439 PE=4 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 1.3e-27 Identity = 57/80 (71.25%), Postives = 67/80 (83.75%), Query Frame = 0
BLAST of Carg23892 vs. TrEMBL
Match: tr|G7LCS2|G7LCS2_MEDTR (Cytochrome P450 family protein OS=Medicago truncatula OX=3880 GN=11446213 PE=4 SV=2) HSP 1 Score: 130.6 bits (327), Expect = 2.2e-27 Identity = 57/68 (83.82%), Postives = 61/68 (89.71%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |