Carg22132 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAATGAAGGAAAAGAAAATGACGGTGATCGGGGAAGTTGATCCAATATGCATGGTGCGAAAACTAAGAAGGTTTCGTCAAACAGAAATAATCTCAGTGGGGCCACCGAAAGAAGAGGAGAAAAAGAAGGCCGAAGATAAAATTGAAGAGGTTCTCAACTACTACAGATATAATGTTCCATTTTATTCGGTTCAACCATATGAACAGCCTCCTACTTGTGTTATTTGTTAG ATGGAAATGAAGGAAAAGAAAATGACGGTGATCGGGGAAGTTGATCCAATATGCATGGTGCGAAAACTAAGAAGGTTTCGTCAAACAGAAATAATCTCAGTGGGGCCACCGAAAGAAGAGGAGAAAAAGAAGGCCGAAGATAAAATTGAAGAGGTTCTCAACTACTACAGATATAATGTTCCATTTTATTCGGTTCAACCATATGAACAGCCTCCTACTTGTGTTATTTGTTAG ATGGAAATGAAGGAAAAGAAAATGACGGTGATCGGGGAAGTTGATCCAATATGCATGGTGCGAAAACTAAGAAGGTTTCGTCAAACAGAAATAATCTCAGTGGGGCCACCGAAAGAAGAGGAGAAAAAGAAGGCCGAAGATAAAATTGAAGAGGTTCTCAACTACTACAGATATAATGTTCCATTTTATTCGGTTCAACCATATGAACAGCCTCCTACTTGTGTTATTTGTTAG MEMKEKKMTVIGEVDPICMVRKLRRFRQTEIISVGPPKEEEKKKAEDKIEEVLNYYRYNVPFYSVQPYEQPPTCVIC
BLAST of Carg22132 vs. NCBI nr
Match: XP_022945780.1 (heavy metal-associated isoprenylated plant protein 39-like [Cucurbita moschata]) HSP 1 Score: 158.7 bits (400), Expect = 8.0e-36 Identity = 77/77 (100.00%), Postives = 77/77 (100.00%), Query Frame = 0
BLAST of Carg22132 vs. NCBI nr
Match: XP_016201007.1 (heavy metal-associated isoprenylated plant protein 39 [Arachis ipaensis] >XP_025656929.1 heavy metal-associated isoprenylated plant protein 39-like [Arachis hypogaea]) HSP 1 Score: 70.9 bits (172), Expect = 2.2e-09 Identity = 38/83 (45.78%), Postives = 54/83 (65.06%), Query Frame = 0
BLAST of Carg22132 vs. NCBI nr
Match: XP_015967352.1 (heavy metal-associated isoprenylated plant protein 39 [Arachis duranensis]) HSP 1 Score: 70.5 bits (171), Expect = 2.9e-09 Identity = 37/83 (44.58%), Postives = 54/83 (65.06%), Query Frame = 0
BLAST of Carg22132 vs. NCBI nr
Match: XP_010671618.1 (PREDICTED: heavy metal-associated isoprenylated plant protein 39 [Beta vulgaris subsp. vulgaris] >KMT16170.1 hypothetical protein BVRB_3g053310 [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 68.2 bits (165), Expect = 1.4e-08 Identity = 39/81 (48.15%), Postives = 56/81 (69.14%), Query Frame = 0
BLAST of Carg22132 vs. NCBI nr
Match: GAV76128.1 (HMA domain-containing protein [Cephalotus follicularis]) HSP 1 Score: 67.4 bits (163), Expect = 2.4e-08 Identity = 39/91 (42.86%), Postives = 55/91 (60.44%), Query Frame = 0
BLAST of Carg22132 vs. TAIR10
Match: AT1G01490.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 50.4 bits (119), Expect = 5.6e-07 Identity = 26/43 (60.47%), Postives = 34/43 (79.07%), Query Frame = 0
BLAST of Carg22132 vs. TAIR10
Match: AT5G52740.1 (Copper transport protein family) HSP 1 Score: 48.9 bits (115), Expect = 1.6e-06 Identity = 24/44 (54.55%), Postives = 33/44 (75.00%), Query Frame = 0
BLAST of Carg22132 vs. TAIR10
Match: AT5G52760.1 (Copper transport protein family) HSP 1 Score: 46.2 bits (108), Expect = 1.1e-05 Identity = 34/89 (38.20%), Postives = 44/89 (49.44%), Query Frame = 0
BLAST of Carg22132 vs. TAIR10
Match: AT5G23760.1 (Copper transport protein family) HSP 1 Score: 44.7 bits (104), Expect = 3.1e-05 Identity = 19/39 (48.72%), Postives = 32/39 (82.05%), Query Frame = 0
BLAST of Carg22132 vs. Swiss-Prot
Match: sp|O03982|HIP39_ARATH (Heavy metal-associated isoprenylated plant protein 39 OS=Arabidopsis thaliana OX=3702 GN=HIPP39 PE=2 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 1.0e-05 Identity = 26/43 (60.47%), Postives = 34/43 (79.07%), Query Frame = 0
BLAST of Carg22132 vs. Swiss-Prot
Match: sp|Q9LTE3|HIP12_ARATH (Heavy metal-associated isoprenylated plant protein 12 OS=Arabidopsis thaliana OX=3702 GN=HIPP12 PE=3 SV=1) HSP 1 Score: 48.9 bits (115), Expect = 2.9e-05 Identity = 24/44 (54.55%), Postives = 33/44 (75.00%), Query Frame = 0
BLAST of Carg22132 vs. Swiss-Prot
Match: sp|Q9LTE1|HIP14_ARATH (Heavy metal-associated isoprenylated plant protein 14 OS=Arabidopsis thaliana OX=3702 GN=HIPP14 PE=2 SV=1) HSP 1 Score: 46.2 bits (108), Expect = 1.9e-04 Identity = 34/89 (38.20%), Postives = 44/89 (49.44%), Query Frame = 0
BLAST of Carg22132 vs. TrEMBL
Match: tr|A0A1Q3C7S5|A0A1Q3C7S5_CEPFO (HMA domain-containing protein OS=Cephalotus follicularis OX=3775 GN=CFOL_v3_19603 PE=4 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 1.6e-08 Identity = 39/91 (42.86%), Postives = 55/91 (60.44%), Query Frame = 0
BLAST of Carg22132 vs. TrEMBL
Match: tr|A0A022RI30|A0A022RI30_ERYGU (Uncharacterized protein OS=Erythranthe guttata OX=4155 GN=MIMGU_mgv11b021772mg PE=4 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 2.7e-08 Identity = 37/90 (41.11%), Postives = 54/90 (60.00%), Query Frame = 0
BLAST of Carg22132 vs. TrEMBL
Match: tr|A0A022RIQ8|A0A022RIQ8_ERYGU (Uncharacterized protein OS=Erythranthe guttata OX=4155 GN=MIMGU_mgv1a020391mg PE=4 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 2.7e-08 Identity = 37/90 (41.11%), Postives = 54/90 (60.00%), Query Frame = 0
BLAST of Carg22132 vs. TrEMBL
Match: tr|A0A2I4HF45|A0A2I4HF45_9ROSI (uncharacterized protein LOC109016874 OS=Juglans regia OX=51240 GN=LOC109016874 PE=4 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.4e-07 Identity = 37/79 (46.84%), Postives = 51/79 (64.56%), Query Frame = 0
BLAST of Carg22132 vs. TrEMBL
Match: tr|A0A2I4G3X7|A0A2I4G3X7_9ROSI (uncharacterized protein LOC109004502 isoform X2 OS=Juglans regia OX=51240 GN=LOC109004502 PE=4 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.4e-07 Identity = 37/79 (46.84%), Postives = 51/79 (64.56%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|