Carg19752 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATGATACCGATGCCGATTCACTAAAAGGTGCAGCCGAGTTCCTGATGGACAATCTTCAAGATCCCGCAGCTATCGTACTAGGCTCCTGTCCAGGCGAAGGAAAAGTGAGTTTAGTAGCAGCATTTACGCCAACTGTTGTTGATCTGGGAGTGCAGGCAAGGAATTTCATAGGACCTATAGCTAAGTTGTGTGGTGGAGGAGGGGGTGGGAGGCCCAATTTTGCTCAGGCAGGTGGAAGAAAACCTGAGAACTTGTTGAACGCCCTCGAAAACGCTCGATCAGAGCTCGTTCGAATCTTATCTGAGAAGGCAAGCTAG ATGGATGATACCGATGCCGATTCACTAAAAGGTGCAGCCGAGTTCCTGATGGACAATCTTCAAGATCCCGCAGCTATCGTACTAGGCTCCTGTCCAGGCGAAGGAAAAGTGAGTTTAGTAGCAGCATTTACGCCAACTGTTGTTGATCTGGGAGTGCAGGCAAGGAATTTCATAGGACCTATAGCTAAGTTGTGTGGTGGAGGAGGGGGTGGGAGGCCCAATTTTGCTCAGGCAGGTGGAAGAAAACCTGAGAACTTGTTGAACGCCCTCGAAAACGCTCGATCAGAGCTCGTTCGAATCTTATCTGAGAAGGCAAGCTAG ATGGATGATACCGATGCCGATTCACTAAAAGGTGCAGCCGAGTTCCTGATGGACAATCTTCAAGATCCCGCAGCTATCGTACTAGGCTCCTGTCCAGGCGAAGGAAAAGTGAGTTTAGTAGCAGCATTTACGCCAACTGTTGTTGATCTGGGAGTGCAGGCAAGGAATTTCATAGGACCTATAGCTAAGTTGTGTGGTGGAGGAGGGGGTGGGAGGCCCAATTTTGCTCAGGCAGGTGGAAGAAAACCTGAGAACTTGTTGAACGCCCTCGAAAACGCTCGATCAGAGCTCGTTCGAATCTTATCTGAGAAGGCAAGCTAG MDDTDADSLKGAAEFLMDNLQDPAAIVLGSCPGEGKVSLVAAFTPTVVDLGVQARNFIGPIAKLCGGGGGGRPNFAQAGGRKPENLLNALENARSELVRILSEKAS
BLAST of Carg19752 vs. NCBI nr
Match: XP_023533448.1 (alanine--tRNA ligase, chloroplastic/mitochondrial isoform X1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 206.8 bits (525), Expect = 3.5e-50 Identity = 105/106 (99.06%), Postives = 106/106 (100.00%), Query Frame = 0
BLAST of Carg19752 vs. NCBI nr
Match: XP_023533450.1 (alanine--tRNA ligase, chloroplastic/mitochondrial isoform X3 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 206.8 bits (525), Expect = 3.5e-50 Identity = 105/106 (99.06%), Postives = 106/106 (100.00%), Query Frame = 0
BLAST of Carg19752 vs. NCBI nr
Match: XP_023533449.1 (alanine--tRNA ligase, chloroplastic/mitochondrial isoform X2 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 206.8 bits (525), Expect = 3.5e-50 Identity = 105/106 (99.06%), Postives = 106/106 (100.00%), Query Frame = 0
BLAST of Carg19752 vs. NCBI nr
Match: XP_022947694.1 (alanine--tRNA ligase, chloroplastic/mitochondrial isoform X1 [Cucurbita moschata]) HSP 1 Score: 206.5 bits (524), Expect = 4.6e-50 Identity = 105/106 (99.06%), Postives = 106/106 (100.00%), Query Frame = 0
BLAST of Carg19752 vs. NCBI nr
Match: XP_022947695.1 (alanine--tRNA ligase, chloroplastic/mitochondrial isoform X2 [Cucurbita moschata]) HSP 1 Score: 206.5 bits (524), Expect = 4.6e-50 Identity = 105/106 (99.06%), Postives = 106/106 (100.00%), Query Frame = 0
BLAST of Carg19752 vs. TAIR10
Match: AT5G22800.1 (Alanyl-tRNA synthetase, class IIc) HSP 1 Score: 152.9 bits (385), Expect = 1.1e-37 Identity = 79/104 (75.96%), Postives = 87/104 (83.65%), Query Frame = 0
BLAST of Carg19752 vs. Swiss-Prot
Match: sp|B9HQZ6|SYAP_POPTR (Alanine--tRNA ligase, chloroplastic/mitochondrial OS=Populus trichocarpa OX=3694 GN=POPTRDRAFT_821063 PE=3 SV=1) HSP 1 Score: 174.5 bits (441), Expect = 6.4e-43 Identity = 86/106 (81.13%), Postives = 96/106 (90.57%), Query Frame = 0
BLAST of Carg19752 vs. Swiss-Prot
Match: sp|Q9FFC7|SYAP_ARATH (Alanine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EMB86 PE=1 SV=2) HSP 1 Score: 152.9 bits (385), Expect = 2.0e-36 Identity = 79/104 (75.96%), Postives = 87/104 (83.65%), Query Frame = 0
BLAST of Carg19752 vs. Swiss-Prot
Match: sp|B8B4H5|SYAP_ORYSI (Alanine--tRNA ligase, chloroplastic/mitochondrial OS=Oryza sativa subsp. indica OX=39946 GN=OsI_22356 PE=3 SV=1) HSP 1 Score: 150.6 bits (379), Expect = 9.8e-36 Identity = 73/104 (70.19%), Postives = 87/104 (83.65%), Query Frame = 0
BLAST of Carg19752 vs. Swiss-Prot
Match: sp|B9FSH5|SYAP_ORYSJ (Alanine--tRNA ligase, chloroplastic/mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=Os06g0245800 PE=3 SV=2) HSP 1 Score: 150.6 bits (379), Expect = 9.8e-36 Identity = 73/104 (70.19%), Postives = 87/104 (83.65%), Query Frame = 0
BLAST of Carg19752 vs. Swiss-Prot
Match: sp|C5Z7K4|SYAP_SORBI (Alanine--tRNA ligase, chloroplastic/mitochondrial OS=Sorghum bicolor OX=4558 GN=Sb10g008780 PE=3 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 2.4e-34 Identity = 72/105 (68.57%), Postives = 87/105 (82.86%), Query Frame = 0
BLAST of Carg19752 vs. TrEMBL
Match: tr|A0A1S3BK22|A0A1S3BK22_CUCME (Probable alanine--tRNA ligase, chloroplastic OS=Cucumis melo OX=3656 GN=LOC103490555 PE=3 SV=1) HSP 1 Score: 191.0 bits (484), Expect = 1.3e-45 Identity = 98/106 (92.45%), Postives = 101/106 (95.28%), Query Frame = 0
BLAST of Carg19752 vs. TrEMBL
Match: tr|A0A0A0KE77|A0A0A0KE77_CUCSA (Alanine--tRNA ligase OS=Cucumis sativus OX=3659 GN=Csa_6G127290 PE=3 SV=1) HSP 1 Score: 189.1 bits (479), Expect = 5.0e-45 Identity = 97/106 (91.51%), Postives = 99/106 (93.40%), Query Frame = 0
BLAST of Carg19752 vs. TrEMBL
Match: tr|A0A2N9I8K7|A0A2N9I8K7_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS48262 PE=4 SV=1) HSP 1 Score: 180.3 bits (456), Expect = 2.3e-42 Identity = 92/106 (86.79%), Postives = 98/106 (92.45%), Query Frame = 0
BLAST of Carg19752 vs. TrEMBL
Match: tr|A0A2P5CKE3|A0A2P5CKE3_9ROSA (Probable alanine--tRNA ligase, chloroplastic OS=Trema orientalis OX=63057 GN=TorRG33x02_281590 PE=3 SV=1) HSP 1 Score: 178.7 bits (452), Expect = 6.8e-42 Identity = 90/106 (84.91%), Postives = 97/106 (91.51%), Query Frame = 0
BLAST of Carg19752 vs. TrEMBL
Match: tr|A0A2P4KQE7|A0A2P4KQE7_QUESU (Alanine--tRNA ligase OS=Quercus suber OX=58331 GN=CFP56_46992 PE=3 SV=1) HSP 1 Score: 177.9 bits (450), Expect = 1.2e-41 Identity = 90/106 (84.91%), Postives = 97/106 (91.51%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|