Carg18684 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCACAGAGGACCGAGAAGGAGGAGACGGAGTTCAAAGTTCCAGAGACGATCACGCTTTGCGTTAACAACTGTGGCCTCACCGGGAATCCGGCGACGAATAATATGTGTCAGAAGTGCTTTAATGCTACCACGGCGGCAGCGGCGGCGGCGGCGGCGACTGCGTCTATGGCGATGAAGTTTTCTGGTGAGAAAAGTCCGAGATCTACTACGTCTCTTTCGCCAGAGAAATTTCGGTTCGTTTCAGAGTCTAGGAGGATTACAACGGCGGCGGATCGTTTTCTCAGATAA ATGGCACAGAGGACCGAGAAGGAGGAGACGGAGTTCAAAGTTCCAGAGACGATCACGCTTTGCGTTAACAACTGTGGCCTCACCGGGAATCCGGCGACGAATAATATGTGTCAGAAGTGCTTTAATGCTACCACGGCGGCAGCGGCGGCGGCGGCGGCGACTGCGTCTATGGCGATGAAGTTTTCTGGTGAGAAAAGTCCGAGATCTACTACGTCTCTTTCGCCAGAGAAATTTCGGTTCGTTTCAGAGTCTAGGAGGATTACAACGGCGGCGGATCGTTTTCTCAGATAA ATGGCACAGAGGACCGAGAAGGAGGAGACGGAGTTCAAAGTTCCAGAGACGATCACGCTTTGCGTTAACAACTGTGGCCTCACCGGGAATCCGGCGACGAATAATATGTGTCAGAAGTGCTTTAATGCTACCACGGCGGCAGCGGCGGCGGCGGCGGCGACTGCGTCTATGGCGATGAAGTTTTCTGGTGAGAAAAGTCCGAGATCTACTACGTCTCTTTCGCCAGAGAAATTTCGGTTCGTTTCAGAGTCTAGGAGGATTACAACGGCGGCGGATCGTTTTCTCAGATAA MAQRTEKEETEFKVPETITLCVNNCGLTGNPATNNMCQKCFNATTAAAAAAAATASMAMKFSGEKSPRSTTSLSPEKFRFVSESRRITTAADRFLR
BLAST of Carg18684 vs. NCBI nr
Match: XP_022991927.1 (zinc finger A20 and AN1 domain-containing stress-associated protein 5 [Cucurbita maxima]) HSP 1 Score: 150.2 bits (378), Expect = 3.6e-33 Identity = 92/93 (98.92%), Postives = 92/93 (98.92%), Query Frame = 0
BLAST of Carg18684 vs. NCBI nr
Match: XP_022954077.1 (zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Cucurbita moschata]) HSP 1 Score: 145.6 bits (366), Expect = 8.7e-32 Identity = 77/93 (82.80%), Postives = 77/93 (82.80%), Query Frame = 0
BLAST of Carg18684 vs. NCBI nr
Match: XP_023549199.1 (zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 144.8 bits (364), Expect = 1.5e-31 Identity = 76/93 (81.72%), Postives = 77/93 (82.80%), Query Frame = 0
BLAST of Carg18684 vs. NCBI nr
Match: XP_023004678.1 (zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Cucurbita maxima]) HSP 1 Score: 142.9 bits (359), Expect = 5.7e-31 Identity = 75/93 (80.65%), Postives = 76/93 (81.72%), Query Frame = 0
BLAST of Carg18684 vs. NCBI nr
Match: XP_004135919.1 (PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5 [Cucumis sativus] >KGN45146.1 hypothetical protein Csa_7G428830 [Cucumis sativus]) HSP 1 Score: 142.1 bits (357), Expect = 9.7e-31 Identity = 75/93 (80.65%), Postives = 75/93 (80.65%), Query Frame = 0
BLAST of Carg18684 vs. TAIR10
Match: AT3G12630.1 (A20/AN1-like zinc finger family protein) HSP 1 Score: 75.1 bits (183), Expect = 2.6e-14 Identity = 36/49 (73.47%), Postives = 39/49 (79.59%), Query Frame = 0
BLAST of Carg18684 vs. TAIR10
Match: AT3G52800.1 (A20/AN1-like zinc finger family protein) HSP 1 Score: 42.4 bits (98), Expect = 1.9e-04 Identity = 17/34 (50.00%), Postives = 22/34 (64.71%), Query Frame = 0
BLAST of Carg18684 vs. TAIR10
Match: AT2G36320.1 (A20/AN1-like zinc finger family protein) HSP 1 Score: 40.8 bits (94), Expect = 5.5e-04 Identity = 17/34 (50.00%), Postives = 21/34 (61.76%), Query Frame = 0
BLAST of Carg18684 vs. Swiss-Prot
Match: sp|Q9LHJ8|SAP5_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 5 OS=Arabidopsis thaliana OX=3702 GN=SAP5 PE=2 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 4.7e-13 Identity = 36/49 (73.47%), Postives = 39/49 (79.59%), Query Frame = 0
BLAST of Carg18684 vs. Swiss-Prot
Match: sp|Q84PD8|SAP11_ORYSJ (Zinc finger A20 and AN1 domain-containing stress-associated protein 11 OS=Oryza sativa subsp. japonica OX=39947 GN=SAP11 PE=2 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.3e-07 Identity = 28/45 (62.22%), Postives = 33/45 (73.33%), Query Frame = 0
BLAST of Carg18684 vs. Swiss-Prot
Match: sp|A2Z2J6|SAP1_ORYSI (Zinc finger A20 and AN1 domain-containing stress-associated protein 1 OS=Oryza sativa subsp. indica OX=39946 GN=SAP1 PE=2 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 3.0e-07 Identity = 28/45 (62.22%), Postives = 32/45 (71.11%), Query Frame = 0
BLAST of Carg18684 vs. Swiss-Prot
Match: sp|A3C039|SAP1_ORYSJ (Zinc finger A20 and AN1 domain-containing stress-associated protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=SAP1 PE=2 SV=2) HSP 1 Score: 55.8 bits (133), Expect = 3.0e-07 Identity = 28/45 (62.22%), Postives = 32/45 (71.11%), Query Frame = 0
BLAST of Carg18684 vs. Swiss-Prot
Match: sp|Q7Y1W9|SAP9_ORYSJ (Zinc finger A20 and AN1 domain-containing stress-associated protein 9 OS=Oryza sativa subsp. japonica OX=39947 GN=SAP9 PE=2 SV=1) HSP 1 Score: 48.9 bits (115), Expect = 3.6e-05 Identity = 24/43 (55.81%), Postives = 28/43 (65.12%), Query Frame = 0
BLAST of Carg18684 vs. TrEMBL
Match: tr|A0A0A0KBH5|A0A0A0KBH5_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G428830 PE=4 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 6.4e-31 Identity = 75/93 (80.65%), Postives = 75/93 (80.65%), Query Frame = 0
BLAST of Carg18684 vs. TrEMBL
Match: tr|A0A1S3CEC2|A0A1S3CEC2_CUCME (zinc finger A20 and AN1 domain-containing stress-associated protein 5 OS=Cucumis melo OX=3656 GN=LOC103499909 PE=4 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 1.1e-30 Identity = 75/93 (80.65%), Postives = 75/93 (80.65%), Query Frame = 0
BLAST of Carg18684 vs. TrEMBL
Match: tr|A0A2P5AX56|A0A2P5AX56_PARAD (Zinc finger transcription factor OS=Parasponia andersonii OX=3476 GN=PanZnF18 PE=4 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 2.8e-18 Identity = 73/96 (76.04%), Postives = 77/96 (80.21%), Query Frame = 0
BLAST of Carg18684 vs. TrEMBL
Match: tr|A0A2P6S787|A0A2P6S787_ROSCH (Putative transcription regulator A20-like family OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr1g0314971 PE=4 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 4.8e-18 Identity = 69/93 (74.19%), Postives = 74/93 (79.57%), Query Frame = 0
BLAST of Carg18684 vs. TrEMBL
Match: tr|A0A2P5E717|A0A2P5E717_9ROSA (Zinc finger transcription factor OS=Trema orientalis OX=63057 GN=TorZnF18 PE=4 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 8.1e-18 Identity = 72/96 (75.00%), Postives = 78/96 (81.25%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |