Carg18655 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGATGGTTATTTTGTGTTCTGAACCAGGCTGATCCTGAAACTGATGAAGTGTATGCACAAATGACCCTTCAACCAGTGAATAAAGTAGGTTAGCCACTCAATAAGTGTTCGATTCATTTATACATTCAAATAATTTGGTTGTTAATACAATATTCTGTTTTGCAGTATGAAAAAGAAGCTTTATTGGCATCTGATATTGGCCTCAAGCAAAACAGGCAGCCTGCTGAGTTCTTCTGCAAAACTCTAACAGCTAGTGACACTAGCACTCACGGTGGATTTTCTGTGCCTCGTCGTGCAGCTGAGAAGATTTTTCCCCCATTAGTGCGCATCACATCTCGTATTCTTTAA ATGAGATGGTTATTTTGTGTTCTGAACCAGGCTGATCCTGAAACTGATGAAGTGTATGCACAAATGACCCTTCAACCAGTGAATAAATATGAAAAAGAAGCTTTATTGGCATCTGATATTGGCCTCAAGCAAAACAGGCAGCCTGCTGAGTTCTTCTGCAAAACTCTAACAGCTAGTGACACTAGCACTCACGGTGGATTTTCTGTGCCTCGTCGTGCAGCTGAGAAGATTTTTCCCCCATTAGTGCGCATCACATCTCGTATTCTTTAA ATGAGATGGTTATTTTGTGTTCTGAACCAGGCTGATCCTGAAACTGATGAAGTGTATGCACAAATGACCCTTCAACCAGTGAATAAATATGAAAAAGAAGCTTTATTGGCATCTGATATTGGCCTCAAGCAAAACAGGCAGCCTGCTGAGTTCTTCTGCAAAACTCTAACAGCTAGTGACACTAGCACTCACGGTGGATTTTCTGTGCCTCGTCGTGCAGCTGAGAAGATTTTTCCCCCATTAGTGCGCATCACATCTCGTATTCTTTAA MRWLFCVLNQADPETDEVYAQMTLQPVNKYEKEALLASDIGLKQNRQPAEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLVRITSRIL
BLAST of Carg18655 vs. NCBI nr
Match: XP_022937523.1 (auxin response factor 19-like isoform X2 [Cucurbita moschata]) HSP 1 Score: 148.7 bits (374), Expect = 9.6e-33 Identity = 72/75 (96.00%), Postives = 73/75 (97.33%), Query Frame = 0
BLAST of Carg18655 vs. NCBI nr
Match: XP_022937522.1 (auxin response factor 19-like isoform X1 [Cucurbita moschata]) HSP 1 Score: 148.7 bits (374), Expect = 9.6e-33 Identity = 72/75 (96.00%), Postives = 73/75 (97.33%), Query Frame = 0
BLAST of Carg18655 vs. NCBI nr
Match: XP_022965393.1 (auxin response factor 19-like isoform X1 [Cucurbita maxima]) HSP 1 Score: 148.7 bits (374), Expect = 9.6e-33 Identity = 72/75 (96.00%), Postives = 73/75 (97.33%), Query Frame = 0
BLAST of Carg18655 vs. NCBI nr
Match: XP_022965395.1 (auxin response factor 19-like isoform X3 [Cucurbita maxima]) HSP 1 Score: 148.7 bits (374), Expect = 9.6e-33 Identity = 72/75 (96.00%), Postives = 73/75 (97.33%), Query Frame = 0
BLAST of Carg18655 vs. NCBI nr
Match: XP_022965394.1 (auxin response factor 19-like isoform X2 [Cucurbita maxima]) HSP 1 Score: 148.7 bits (374), Expect = 9.6e-33 Identity = 72/75 (96.00%), Postives = 73/75 (97.33%), Query Frame = 0
BLAST of Carg18655 vs. TAIR10
Match: AT1G19220.1 (auxin response factor 19) HSP 1 Score: 138.3 bits (347), Expect = 2.3e-33 Identity = 68/82 (82.93%), Postives = 73/82 (89.02%), Query Frame = 0
BLAST of Carg18655 vs. TAIR10
Match: AT5G20730.1 (Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related) HSP 1 Score: 136.3 bits (342), Expect = 8.9e-33 Identity = 67/82 (81.71%), Postives = 73/82 (89.02%), Query Frame = 0
BLAST of Carg18655 vs. TAIR10
Match: AT1G30330.2 (auxin response factor 6) HSP 1 Score: 106.3 bits (264), Expect = 9.9e-24 Identity = 53/76 (69.74%), Postives = 62/76 (81.58%), Query Frame = 0
BLAST of Carg18655 vs. TAIR10
Match: AT5G37020.1 (auxin response factor 8) HSP 1 Score: 102.8 bits (255), Expect = 1.1e-22 Identity = 51/76 (67.11%), Postives = 61/76 (80.26%), Query Frame = 0
BLAST of Carg18655 vs. TAIR10
Match: AT1G19850.1 (Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related) HSP 1 Score: 99.8 bits (247), Expect = 9.3e-22 Identity = 48/72 (66.67%), Postives = 59/72 (81.94%), Query Frame = 0
BLAST of Carg18655 vs. Swiss-Prot
Match: sp|Q8RYC8|ARFS_ARATH (Auxin response factor 19 OS=Arabidopsis thaliana OX=3702 GN=ARF19 PE=1 SV=2) HSP 1 Score: 138.3 bits (347), Expect = 4.2e-32 Identity = 68/82 (82.93%), Postives = 73/82 (89.02%), Query Frame = 0
BLAST of Carg18655 vs. Swiss-Prot
Match: sp|A3B9A0|ARFP_ORYSJ (Auxin response factor 16 OS=Oryza sativa subsp. japonica OX=39947 GN=ARF16 PE=2 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 1.2e-31 Identity = 63/71 (88.73%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of Carg18655 vs. Swiss-Prot
Match: sp|P93022|ARFG_ARATH (Auxin response factor 7 OS=Arabidopsis thaliana OX=3702 GN=ARF7 PE=1 SV=2) HSP 1 Score: 136.3 bits (342), Expect = 1.6e-31 Identity = 67/82 (81.71%), Postives = 73/82 (89.02%), Query Frame = 0
BLAST of Carg18655 vs. Swiss-Prot
Match: sp|A2YAA5|ARFP_ORYSI (Auxin response factor 16 OS=Oryza sativa subsp. indica OX=39946 GN=ARF16 PE=2 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 3.6e-31 Identity = 62/71 (87.32%), Postives = 69/71 (97.18%), Query Frame = 0
BLAST of Carg18655 vs. Swiss-Prot
Match: sp|Q6Z2W3|ARFE_ORYSJ (Auxin response factor 5 OS=Oryza sativa subsp. japonica OX=39947 GN=ARF5 PE=2 SV=2) HSP 1 Score: 123.6 bits (309), Expect = 1.1e-27 Identity = 62/82 (75.61%), Postives = 67/82 (81.71%), Query Frame = 0
BLAST of Carg18655 vs. TrEMBL
Match: tr|A0A1S3CC20|A0A1S3CC20_CUCME (Auxin response factor OS=Cucumis melo OX=3656 GN=LOC103498967 PE=3 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 1.8e-32 Identity = 73/82 (89.02%), Postives = 76/82 (92.68%), Query Frame = 0
BLAST of Carg18655 vs. TrEMBL
Match: tr|A0A1S3CBQ4|A0A1S3CBQ4_CUCME (Auxin response factor OS=Cucumis melo OX=3656 GN=LOC103498967 PE=3 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 1.8e-32 Identity = 73/82 (89.02%), Postives = 76/82 (92.68%), Query Frame = 0
BLAST of Carg18655 vs. TrEMBL
Match: tr|A0A0A0LHN1|A0A0A0LHN1_CUCSA (Auxin response factor OS=Cucumis sativus OX=3659 GN=Csa_2G000030 PE=3 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 1.8e-32 Identity = 73/82 (89.02%), Postives = 76/82 (92.68%), Query Frame = 0
BLAST of Carg18655 vs. TrEMBL
Match: tr|Q6L8U3|Q6L8U3_CUCSA (Auxin response factor OS=Cucumis sativus OX=3659 GN=CsARF1 PE=2 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 1.8e-32 Identity = 73/82 (89.02%), Postives = 76/82 (92.68%), Query Frame = 0
BLAST of Carg18655 vs. TrEMBL
Match: tr|A0A1U8IWB7|A0A1U8IWB7_GOSHI (Auxin response factor OS=Gossypium hirsutum OX=3635 GN=LOC107901036 PE=3 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 4.1e-32 Identity = 72/82 (87.80%), Postives = 76/82 (92.68%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|