Carg17421 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCTCACCGAAACCTCGAGACGTTAAATGCGTATATATCCAATTCTGTGCTCCATGGGCGGGCTGAGGACTCTACCATTGCATTTATTGAGCCACTTCGAGTTGGTGGGAAGGCAGATTCAATAATGTCTGCTTTTCTCAATGCGTATTCAGAGAAACTAGGCTGGGTGCATGGGTGTCAGCTACATGGGTTCATTATTCGAAGTGGGTGTGCGCAGAATGTCTCTGTTTCAAATGGGTTGATAGCTTTTTATGGGAAATGTGGGGAGGTTGAATGCTCTGAGATGGTTTTTGACAGAATGGGAGAGCGGAAGAGAAAATGCCTGTGAGAAACTTAGTGTCTTGGAATACGTTGTTGGGCGGATACGCAGACAAGGCTGTGGCGTTGCTCGAGGAGATGGCATCGATGGTGGGCATGGCGCCGAGCTATGTAAGCTTGGTTTGTGCATTATCAGCTTGCAGTAGAGCAGGAGATTTGAAGATGGGGATGCAGATTTTCTGA ATGCCTCACCGAAACCTCGAGACGTTAAATGCGTATATATCCAATTCTGTGCTCCATGGGCGGGCTGAGGACTCTACCATTGCATTTATTGAGCCACTTCGAGTTGGTGGGAAGGCAGATTCAATAATGTCTGCTTTTCTCAATGCGTATTCAGAGAAACTAGGCTGGGTGCATGGGTGTCAGCTACATGGGTTCATTATTCGAAGTGGGTGTGCGCAGAATGTCTCTGTTTCAAATGGGTTGATAGCTTTTTATGGGAAATGTGGGGAGGTTGAATGCTCTGAGATGAATGGGAGAGCGGAAGAGAAAATGCCTGTGAGAAACTTAGTGTCTTGGAATACGTTGTTGGGCGGATACGCAGACAAGGCTGTGGCGTTGCTCGAGGAGATGGCATCGATGGTGGGCATGGCGCCGAGCTATGTAAGCTTGGTTTGTGCATTATCAGCTTGCAGTAGAGCAGGAGATTTGAAGATGGGGATGCAGATTTTCTGA ATGCCTCACCGAAACCTCGAGACGTTAAATGCGTATATATCCAATTCTGTGCTCCATGGGCGGGCTGAGGACTCTACCATTGCATTTATTGAGCCACTTCGAGTTGGTGGGAAGGCAGATTCAATAATGTCTGCTTTTCTCAATGCGTATTCAGAGAAACTAGGCTGGGTGCATGGGTGTCAGCTACATGGGTTCATTATTCGAAGTGGGTGTGCGCAGAATGTCTCTGTTTCAAATGGGTTGATAGCTTTTTATGGGAAATGTGGGGAGGTTGAATGCTCTGAGATGAATGGGAGAGCGGAAGAGAAAATGCCTGTGAGAAACTTAGTGTCTTGGAATACGTTGTTGGGCGGATACGCAGACAAGGCTGTGGCGTTGCTCGAGGAGATGGCATCGATGGTGGGCATGGCGCCGAGCTATGTAAGCTTGGTTTGTGCATTATCAGCTTGCAGTAGAGCAGGAGATTTGAAGATGGGGATGCAGATTTTCTGA MPHRNLETLNAYISNSVLHGRAEDSTIAFIEPLRVGGKADSIMSAFLNAYSEKLGWVHGCQLHGFIIRSGCAQNVSVSNGLIAFYGKCGEVECSEMNGRAEEKMPVRNLVSWNTLLGGYADKAVALLEEMASMVGMAPSYVSLVCALSACSRAGDLKMGMQIF
BLAST of Carg17421 vs. NCBI nr
Match: XP_022979420.1 (pentatricopeptide repeat-containing protein At4g14850 [Cucurbita maxima] >XP_022979421.1 pentatricopeptide repeat-containing protein At4g14850 [Cucurbita maxima] >XP_022979423.1 pentatricopeptide repeat-containing protein At4g14850 [Cucurbita maxima] >XP_022979424.1 pentatricopeptide repeat-containing protein At4g14850 [Cucurbita maxima] >XP_022979425.1 pentatricopeptide repeat-containing protein At4g14850 [Cucurbita maxima] >XP_022979426.1 pentatricopeptide repeat-containing protein At4g14850 [Cucurbita maxima]) HSP 1 Score: 211.1 bits (536), Expect = 2.9e-51 Identity = 136/267 (50.94%), Postives = 141/267 (52.81%), Query Frame = 0
BLAST of Carg17421 vs. NCBI nr
Match: XP_022956070.1 (pentatricopeptide repeat-containing protein At4g14850 [Cucurbita moschata]) HSP 1 Score: 209.1 bits (531), Expect = 1.1e-50 Identity = 133/267 (49.81%), Postives = 140/267 (52.43%), Query Frame = 0
BLAST of Carg17421 vs. NCBI nr
Match: XP_004134445.1 (PREDICTED: pentatricopeptide repeat-containing protein At4g14850 [Cucumis sativus] >XP_011650980.1 PREDICTED: pentatricopeptide repeat-containing protein At4g14850 [Cucumis sativus] >KGN56980.1 hypothetical protein Csa_3G146650 [Cucumis sativus]) HSP 1 Score: 206.5 bits (524), Expect = 7.1e-50 Identity = 133/267 (49.81%), Postives = 138/267 (51.69%), Query Frame = 0
BLAST of Carg17421 vs. NCBI nr
Match: XP_022137756.1 (pentatricopeptide repeat-containing protein At4g14850 [Momordica charantia]) HSP 1 Score: 204.9 bits (520), Expect = 2.1e-49 Identity = 133/267 (49.81%), Postives = 139/267 (52.06%), Query Frame = 0
BLAST of Carg17421 vs. NCBI nr
Match: XP_008438671.1 (PREDICTED: pentatricopeptide repeat-containing protein At4g14850 [Cucumis melo]) HSP 1 Score: 198.7 bits (504), Expect = 1.5e-47 Identity = 129/267 (48.31%), Postives = 136/267 (50.94%), Query Frame = 0
BLAST of Carg17421 vs. TAIR10
Match: AT4G14850.1 (Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 111.3 bits (277), Expect = 5.6e-25 Identity = 90/271 (33.21%), Postives = 117/271 (43.17%), Query Frame = 0
BLAST of Carg17421 vs. TAIR10
Match: AT3G22690.1 (Protein of unknown function DUF1685 (InterPro:IPR012881), Pentatricopeptide repeat (InterPro:IPR002885)) HSP 1 Score: 84.0 bits (206), Expect = 9.6e-17 Identity = 47/160 (29.38%), Postives = 87/160 (54.37%), Query Frame = 0
BLAST of Carg17421 vs. TAIR10
Match: AT1G68930.1 (pentatricopeptide (PPR) repeat-containing protein) HSP 1 Score: 83.6 bits (205), Expect = 1.3e-16 Identity = 56/168 (33.33%), Postives = 86/168 (51.19%), Query Frame = 0
BLAST of Carg17421 vs. TAIR10
Match: AT3G02010.1 (Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 81.3 bits (199), Expect = 6.2e-16 Identity = 57/168 (33.93%), Postives = 83/168 (49.40%), Query Frame = 0
BLAST of Carg17421 vs. TAIR10
Match: AT5G50390.1 (Pentatricopeptide repeat (PPR-like) superfamily protein) HSP 1 Score: 81.3 bits (199), Expect = 6.2e-16 Identity = 51/169 (30.18%), Postives = 85/169 (50.30%), Query Frame = 0
BLAST of Carg17421 vs. Swiss-Prot
Match: sp|Q0WSH6|PP312_ARATH (Pentatricopeptide repeat-containing protein At4g14850 OS=Arabidopsis thaliana OX=3702 GN=LOI1 PE=1 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 1.0e-23 Identity = 90/271 (33.21%), Postives = 117/271 (43.17%), Query Frame = 0
BLAST of Carg17421 vs. Swiss-Prot
Match: sp|Q9LUJ2|PP249_ARATH (Pentatricopeptide repeat-containing protein At3g22690 OS=Arabidopsis thaliana OX=3702 GN=PCMP-H56 PE=3 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 1.7e-15 Identity = 47/160 (29.38%), Postives = 87/160 (54.37%), Query Frame = 0
BLAST of Carg17421 vs. Swiss-Prot
Match: sp|Q9CAA8|PP108_ARATH (Putative pentatricopeptide repeat-containing protein At1g68930 OS=Arabidopsis thaliana OX=3702 GN=PCMP-H22 PE=3 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 2.3e-15 Identity = 56/168 (33.33%), Postives = 86/168 (51.19%), Query Frame = 0
BLAST of Carg17421 vs. Swiss-Prot
Match: sp|Q9S7F4|PP206_ARATH (Putative pentatricopeptide repeat-containing protein At2g01510 OS=Arabidopsis thaliana OX=3702 GN=PCMP-H36 PE=3 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 1.1e-14 Identity = 57/168 (33.93%), Postives = 83/168 (49.40%), Query Frame = 0
BLAST of Carg17421 vs. Swiss-Prot
Match: sp|Q9FK33|PP427_ARATH (Pentatricopeptide repeat-containing protein At5g50390, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PCMP-H58 PE=2 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 1.1e-14 Identity = 51/169 (30.18%), Postives = 85/169 (50.30%), Query Frame = 0
BLAST of Carg17421 vs. TrEMBL
Match: tr|A0A0A0L4T8|A0A0A0L4T8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G146650 PE=4 SV=1) HSP 1 Score: 206.5 bits (524), Expect = 4.7e-50 Identity = 133/267 (49.81%), Postives = 138/267 (51.69%), Query Frame = 0
BLAST of Carg17421 vs. TrEMBL
Match: tr|A0A1S3AXN0|A0A1S3AXN0_CUCME (pentatricopeptide repeat-containing protein At4g14850 OS=Cucumis melo OX=3656 GN=LOC103483708 PE=4 SV=1) HSP 1 Score: 198.7 bits (504), Expect = 9.8e-48 Identity = 129/267 (48.31%), Postives = 136/267 (50.94%), Query Frame = 0
BLAST of Carg17421 vs. TrEMBL
Match: tr|A0A2G5DN36|A0A2G5DN36_AQUCA (Uncharacterized protein OS=Aquilegia coerulea OX=218851 GN=AQUCO_01700478v1 PE=4 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 1.9e-27 Identity = 94/271 (34.69%), Postives = 124/271 (45.76%), Query Frame = 0
BLAST of Carg17421 vs. TrEMBL
Match: tr|A0A2G5CS48|A0A2G5CS48_AQUCA (Uncharacterized protein OS=Aquilegia coerulea OX=218851 GN=AQUCO_03900202v1 PE=4 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 2.5e-27 Identity = 95/271 (35.06%), Postives = 123/271 (45.39%), Query Frame = 0
BLAST of Carg17421 vs. TrEMBL
Match: tr|A0A2I4GEW5|A0A2I4GEW5_9ROSI (pentatricopeptide repeat-containing protein At4g14850 OS=Juglans regia OX=51240 GN=LOC109007283 PE=4 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 1.6e-26 Identity = 96/268 (35.82%), Postives = 120/268 (44.78%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |