Carg16708 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.GAGCAGAGAAAGCGGCAGATTCATGGAGGGGTGATTAATTTGGGGCTAGGTGATCATTATGTGCAAAACTCGCGGATTCGTTGCTATGGAGCTTGTGGGGATTTTTCTAGTGCAGGTAGGGTGTTTGATGAAATGTTTGTTTGAGATGTTGTGTCCTGGACTATCATGATCGCTGGATTGGGGCAGAGTAACCATCCAAAAGAGTCCTTGGAGCTGTTTTCAAAGATGCGAAGCTTGGGTATTGGCCCTGATGGGATTATTTGAACTAGTGTTCTCTCTGCTTGTGCTAGCCTAGGAAGTCTTGGCTTTGGCACATGGGTCCATGAGTACATAGATCAAAGAGGAATCAAATGGAATATCCGTATTGGAACTGCTATTGTTGACATGTATGCCAAATGTTGGTGCATCGAAATGGCACTGCAAATCTTTAACAATATGCCTCAAAGAAATATACCTTCACTTGGAATGCCCTGCTATGCGGTCTGGCATTGCATGGAGTTGTGCAGGAAGCAT GAGCAGAGAAAGCGGCAGATTCATGGAGGGGTGATTAATTTGGGGCTAGGTGATCATTATGTGCAAAACTCGCGGATTCGTTGCTATGGAGCTTGTGGGGATTTTTCTAGTGCAGATGTTGTGTCCTGGACTATCATGATCGCTGGATTGGGGCAGAGTAACCATCCAAAAGAGTCCTTGGAGCTGTTTTCAAAGATGCGAAGCTTGGGAAGTCTTGGCTTTGGCACATGGGTCCATGAGTACATAGATCAAAGAGGAATCAAATGGAATATCCGTATTGGAACTGCTATTGTTGACATGTATGCCAAATGTTGGTGCATCGAAATGGCACTGCAAATCTTTAACAATATGCCTCAAAGAAATATACCTTCACTTGGAATGCCCTGCTATGCGGTCTGGCATTGCATGGAGTTGTGCAGGAAGCAT GAGCAGAGAAAGCGGCAGATTCATGGAGGGGTGATTAATTTGGGGCTAGGTGATCATTATGTGCAAAACTCGCGGATTCGTTGCTATGGAGCTTGTGGGGATTTTTCTAGTGCAGATGTTGTGTCCTGGACTATCATGATCGCTGGATTGGGGCAGAGTAACCATCCAAAAGAGTCCTTGGAGCTGTTTTCAAAGATGCGAAGCTTGGGAAGTCTTGGCTTTGGCACATGGGTCCATGAGTACATAGATCAAAGAGGAATCAAATGGAATATCCGTATTGGAACTGCTATTGTTGACATGTATGCCAAATGTTGGTGCATCGAAATGGCACTGCAAATCTTTAACAATATGCCTCAAAGAAATATACCTTCACTTGGAATGCCCTGCTATGCGGTCTGGCATTGCATGGAGTTGTGCAGGAAGCAT EQRKRQIHGGVINLGLGDHYVQNSRIRCYGACGDFSSADVVSWTIMIAGLGQSNHPKESLELFSKMRSLGSLGFGTWVHEYIDQRGIKWNIRIGTAIVDMYAKCWCIEMALQIFNNMPQRNIPSLGMPCYAVWHCMELCRKH
BLAST of Carg16708 vs. NCBI nr
Match: XP_022984447.1 (pentatricopeptide repeat-containing protein At4g38010-like [Cucurbita maxima]) HSP 1 Score: 151.0 bits (380), Expect = 3.1e-33 Identity = 76/102 (74.51%), Postives = 79/102 (77.45%), Query Frame = 0
BLAST of Carg16708 vs. NCBI nr
Match: XP_022141237.1 (pentatricopeptide repeat-containing protein At4g38010 [Momordica charantia]) HSP 1 Score: 147.1 bits (370), Expect = 4.4e-32 Identity = 76/131 (58.02%), Postives = 87/131 (66.41%), Query Frame = 0
BLAST of Carg16708 vs. NCBI nr
Match: KGN60620.1 (hypothetical protein Csa_2G004700 [Cucumis sativus]) HSP 1 Score: 144.1 bits (362), Expect = 3.8e-31 Identity = 94/244 (38.52%), Postives = 104/244 (42.62%), Query Frame = 0
BLAST of Carg16708 vs. NCBI nr
Match: XP_011648657.1 (PREDICTED: pentatricopeptide repeat-containing protein At4g38010 isoform X1 [Cucumis sativus]) HSP 1 Score: 144.1 bits (362), Expect = 3.8e-31 Identity = 94/244 (38.52%), Postives = 104/244 (42.62%), Query Frame = 0
BLAST of Carg16708 vs. NCBI nr
Match: XP_011648658.1 (PREDICTED: pentatricopeptide repeat-containing protein At4g38010 isoform X2 [Cucumis sativus]) HSP 1 Score: 144.1 bits (362), Expect = 3.8e-31 Identity = 94/244 (38.52%), Postives = 104/244 (42.62%), Query Frame = 0
BLAST of Carg16708 vs. TAIR10
Match: AT4G38010.1 (Pentatricopeptide repeat (PPR-like) superfamily protein) HSP 1 Score: 95.5 bits (236), Expect = 2.8e-20 Identity = 49/110 (44.55%), Postives = 62/110 (56.36%), Query Frame = 0
BLAST of Carg16708 vs. TAIR10
Match: AT3G57430.1 (Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 80.9 bits (198), Expect = 7.1e-16 Identity = 47/161 (29.19%), Postives = 76/161 (47.20%), Query Frame = 0
BLAST of Carg16708 vs. TAIR10
Match: AT1G69350.1 (Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 80.1 bits (196), Expect = 1.2e-15 Identity = 50/149 (33.56%), Postives = 69/149 (46.31%), Query Frame = 0
BLAST of Carg16708 vs. TAIR10
Match: AT4G18520.1 (Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 79.7 bits (195), Expect = 1.6e-15 Identity = 43/146 (29.45%), Postives = 74/146 (50.68%), Query Frame = 0
BLAST of Carg16708 vs. TAIR10
Match: AT3G28660.1 (Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 79.3 bits (194), Expect = 2.1e-15 Identity = 46/150 (30.67%), Postives = 74/150 (49.33%), Query Frame = 0
BLAST of Carg16708 vs. Swiss-Prot
Match: sp|Q9SZK1|PP355_ARATH (Pentatricopeptide repeat-containing protein At4g38010 OS=Arabidopsis thaliana OX=3702 GN=PCMP-E45 PE=3 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 5.0e-19 Identity = 49/110 (44.55%), Postives = 62/110 (56.36%), Query Frame = 0
BLAST of Carg16708 vs. Swiss-Prot
Match: sp|Q7Y211|PP285_ARATH (Pentatricopeptide repeat-containing protein At3g57430, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PCMP-H81 PE=2 SV=2) HSP 1 Score: 80.9 bits (198), Expect = 1.3e-14 Identity = 47/161 (29.19%), Postives = 76/161 (47.20%), Query Frame = 0
BLAST of Carg16708 vs. Swiss-Prot
Match: sp|Q9C507|PP111_ARATH (Putative pentatricopeptide repeat-containing protein At1g69350, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PCMP-E66 PE=3 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 2.2e-14 Identity = 50/149 (33.56%), Postives = 69/149 (46.31%), Query Frame = 0
BLAST of Carg16708 vs. Swiss-Prot
Match: sp|Q0WNP3|PP319_ARATH (Pentatricopeptide repeat-containing protein At4g18520, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PCMP-A2 PE=1 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 2.9e-14 Identity = 43/146 (29.45%), Postives = 74/146 (50.68%), Query Frame = 0
BLAST of Carg16708 vs. Swiss-Prot
Match: sp|Q9LJI9|PP260_ARATH (Pentatricopeptide repeat-containing protein At3g28660 OS=Arabidopsis thaliana OX=3702 GN=PCMP-E80 PE=2 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 3.7e-14 Identity = 46/150 (30.67%), Postives = 74/150 (49.33%), Query Frame = 0
BLAST of Carg16708 vs. TrEMBL
Match: tr|A0A0A0LF19|A0A0A0LF19_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G004700 PE=4 SV=1) HSP 1 Score: 144.1 bits (362), Expect = 2.5e-31 Identity = 94/244 (38.52%), Postives = 104/244 (42.62%), Query Frame = 0
BLAST of Carg16708 vs. TrEMBL
Match: tr|A0A1S3C7P6|A0A1S3C7P6_CUCME (pentatricopeptide repeat-containing protein At4g38010 isoform X1 OS=Cucumis melo OX=3656 GN=LOC103497763 PE=4 SV=1) HSP 1 Score: 142.5 bits (358), Expect = 7.2e-31 Identity = 81/147 (55.10%), Postives = 93/147 (63.27%), Query Frame = 0
BLAST of Carg16708 vs. TrEMBL
Match: tr|A0A1S3C7K9|A0A1S3C7K9_CUCME (pentatricopeptide repeat-containing protein At4g38010 isoform X2 OS=Cucumis melo OX=3656 GN=LOC103497763 PE=4 SV=1) HSP 1 Score: 142.5 bits (358), Expect = 7.2e-31 Identity = 81/147 (55.10%), Postives = 93/147 (63.27%), Query Frame = 0
BLAST of Carg16708 vs. TrEMBL
Match: tr|W9S388|W9S388_9ROSA (Uncharacterized protein OS=Morus notabilis OX=981085 GN=L484_005358 PE=4 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 8.3e-27 Identity = 63/132 (47.73%), Postives = 84/132 (63.64%), Query Frame = 0
BLAST of Carg16708 vs. TrEMBL
Match: tr|A0A251QN06|A0A251QN06_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_2G288100 PE=4 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 4.5e-25 Identity = 64/148 (43.24%), Postives = 84/148 (56.76%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|