Carg15939 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAATGAGGCTGGTTAGGGGGCGAAGTCTGACTGACCCTAATTATGCATTAACGGACATATGTATCTTTGAGTATCAAAGTACACTCTCAGATTAACGGATGCTGGTTTAATGCATTTAGTGAAGAGATGCACCATGCTTGAATCCTGCCAAATGGTCTATTGTCCTGGCATCACCGCAGCTGGCGTCGCCACTGTCGTTTCCAGCTGCCCAAGCGTAAAGAAAATTCTGGTCGAGAAATGGAAGGTGAGCGAGAGAACAAAACGACGTGCAGGCTCGGTCATTTCCTACCTTTGCGTCGACCTCTAG ATGGCAATGAGGCTGTACACTCTCAGATTAACGGATGCTGGTTTAATGCATTTAGTGAAGAGATGCACCATGCTTGAATCCTGCCAAATGGTCTATTGTCCTGGCATCACCGCAGCTGGCGTCGCCACTGTCGTTTCCAGCTGCCCAAGCGTAAAGAAAATTCTGGTCGAGAAATGGAAGGTGAGCGAGAGAACAAAACGACGTGCAGGCTCGGTCATTTCCTACCTTTGCGTCGACCTCTAG ATGGCAATGAGGCTGTACACTCTCAGATTAACGGATGCTGGTTTAATGCATTTAGTGAAGAGATGCACCATGCTTGAATCCTGCCAAATGGTCTATTGTCCTGGCATCACCGCAGCTGGCGTCGCCACTGTCGTTTCCAGCTGCCCAAGCGTAAAGAAAATTCTGGTCGAGAAATGGAAGGTGAGCGAGAGAACAAAACGACGTGCAGGCTCGGTCATTTCCTACCTTTGCGTCGACCTCTAG MAMRLYTLRLTDAGLMHLVKRCTMLESCQMVYCPGITAAGVATVVSSCPSVKKILVEKWKVSERTKRRAGSVISYLCVDL
BLAST of Carg15939 vs. NCBI nr
Match: PNR45541.1 (hypothetical protein PHYPA_015312, partial [Physcomitrella patens]) HSP 1 Score: 75.1 bits (183), Expect = 1.2e-10 Identity = 33/80 (41.25%), Postives = 52/80 (65.00%), Query Frame = 0
BLAST of Carg15939 vs. NCBI nr
Match: POE98043.1 (f-box/lrr-repeat protein 4 [Quercus suber]) HSP 1 Score: 70.1 bits (170), Expect = 3.9e-09 Identity = 31/40 (77.50%), Postives = 38/40 (95.00%), Query Frame = 0
BLAST of Carg15939 vs. NCBI nr
Match: POE98042.1 (f-box/lrr-repeat protein 4 [Quercus suber]) HSP 1 Score: 70.1 bits (170), Expect = 3.9e-09 Identity = 31/40 (77.50%), Postives = 38/40 (95.00%), Query Frame = 0
BLAST of Carg15939 vs. NCBI nr
Match: XP_023000156.1 (F-box/LRR-repeat protein 4 isoform X1 [Cucurbita maxima]) HSP 1 Score: 62.8 bits (151), Expect = 6.2e-07 Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 0
BLAST of Carg15939 vs. NCBI nr
Match: XP_023000157.1 (F-box/LRR-repeat protein 4 isoform X2 [Cucurbita maxima]) HSP 1 Score: 62.8 bits (151), Expect = 6.2e-07 Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 0
BLAST of Carg15939 vs. TAIR10
Match: AT4G15475.1 (F-box/RNI-like superfamily protein) HSP 1 Score: 57.0 bits (136), Expect = 6.2e-09 Identity = 24/30 (80.00%), Postives = 29/30 (96.67%), Query Frame = 0
BLAST of Carg15939 vs. TAIR10
Match: AT3G50080.1 (VIER F-box proteine 2) HSP 1 Score: 40.4 bits (93), Expect = 6.0e-04 Identity = 24/78 (30.77%), Postives = 45/78 (57.69%), Query Frame = 0
BLAST of Carg15939 vs. Swiss-Prot
Match: sp|Q9C5D2|FBL4_ARATH (F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana OX=3702 GN=FBL4 PE=2 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.1e-07 Identity = 24/30 (80.00%), Postives = 29/30 (96.67%), Query Frame = 0
BLAST of Carg15939 vs. TrEMBL
Match: tr|A0A2K1JVI6|A0A2K1JVI6_PHYPA (Uncharacterized protein (Fragment) OS=Physcomitrella patens subsp. patens OX=3218 GN=PHYPA_015312 PE=4 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 8.0e-11 Identity = 33/80 (41.25%), Postives = 52/80 (65.00%), Query Frame = 0
BLAST of Carg15939 vs. TrEMBL
Match: tr|A0A2P4KYH3|A0A2P4KYH3_QUESU (F-box/lrr-repeat protein 4 OS=Quercus suber OX=58331 GN=CFP56_39486 PE=4 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 2.6e-09 Identity = 31/40 (77.50%), Postives = 38/40 (95.00%), Query Frame = 0
BLAST of Carg15939 vs. TrEMBL
Match: tr|A0A2P4KYF2|A0A2P4KYF2_QUESU (F-box/lrr-repeat protein 4 OS=Quercus suber OX=58331 GN=CFP56_39486 PE=4 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 2.6e-09 Identity = 31/40 (77.50%), Postives = 38/40 (95.00%), Query Frame = 0
BLAST of Carg15939 vs. TrEMBL
Match: tr|A0A0A0KCP6|A0A0A0KCP6_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G062270 PE=4 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.6e-06 Identity = 28/29 (96.55%), Postives = 29/29 (100.00%), Query Frame = 0
BLAST of Carg15939 vs. TrEMBL
Match: tr|A0A2P2KM93|A0A2P2KM93_RHIMU (Uncharacterized protein OS=Rhizophora mucronata OX=61149 PE=4 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 2.0e-06 Identity = 27/29 (93.10%), Postives = 29/29 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |