Carg15469 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: exonfive_prime_UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.AAAAGCATCTATACTTCTGGTGGCCTAAAACTTTCTCTCTTCTTTCTTCATATATTTTACAATGTCAGCTGTGGTTGGTTCTCTCTCAACCAAGAACGTTAAGTTCAACCCTCAAGTAGGGGAGGAAGAGCTCAGTAAGTCTATGAACGATCGAGAAGGAGAAGAGATTATTGAAGAAGACGAAGATGACAAACTTAAGCCTGAGGGAGAAGTCGATCTCGGTCCTCGATTCTCTATCAAGGAACAACTCGAGAAAGATAAGGTAAGTTCGTAAGATTGAGTTTGATATGACTTTTTAACAATACTTTTGTTGATCCGTCATAGCTTTGGTTTTGTTTGTCTAGGATGATGAAAGCTTGAGAAAATGGAAGGAACAGTTGTTGGGTAGTGTTGATCTCTCTGCCATTGGAGGTGAACATGAATTTCTTCTTTGTGTTGATGCTATTTAA AAAAGCATCTATACTTCTGGTGGCCTAAAACTTTCTCTCTTCTTTCTTCATATATTTTACAATGTCAGCTGTGGTTGGTTCTCTCTCAACCAAGAACGTTAAGTTCAACCCTCAAGTAGGGGAGGAAGAGCTCAGTAAGTCTATGAACGATCGAGAAGGAGAAGAGATTATTGAAGAAGACGAAGATGACAAACTTAAGCCTGAGGGAGAAGTCGATCTCGGTCCTCGATTCTCTATCAAGGAACAACTCGAGAAAGATAAGGATGATGAAAGCTTGAGAAAATGGAAGGAACAGTTGTTGGGTAGTGTTGATCTCTCTGCCATTGGAGGTGAACATGAATTTCTTCTTTGTGTTGATGCTATTTAA ATGTCAGCTGTGGTTGGTTCTCTCTCAACCAAGAACGTTAAGTTCAACCCTCAAGTAGGGGAGGAAGAGCTCAGTAAGTCTATGAACGATCGAGAAGGAGAAGAGATTATTGAAGAAGACGAAGATGACAAACTTAAGCCTGAGGGAGAAGTCGATCTCGGTCCTCGATTCTCTATCAAGGAACAACTCGAGAAAGATAAGGATGATGAAAGCTTGAGAAAATGGAAGGAACAGTTGTTGGGTAGTGTTGATCTCTCTGCCATTGGAGGTGAACATGAATTTCTTCTTTGTGTTGATGCTATTTAA MSAVVGSLSTKNVKFNPQVGEEELSKSMNDREGEEIIEEDEDDKLKPEGEVDLGPRFSIKEQLEKDKDDESLRKWKEQLLGSVDLSAIGGEHEFLLCVDAI
BLAST of Carg15469 vs. NCBI nr
Match: XP_022932679.1 (rho GDP-dissociation inhibitor 1-like isoform X1 [Cucurbita moschata]) HSP 1 Score: 168.7 bits (426), Expect = 1.0e-38 Identity = 89/93 (95.70%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Carg15469 vs. NCBI nr
Match: XP_023538815.1 (rho GDP-dissociation inhibitor 1-like isoform X1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 168.3 bits (425), Expect = 1.3e-38 Identity = 89/93 (95.70%), Postives = 89/93 (95.70%), Query Frame = 0
BLAST of Carg15469 vs. NCBI nr
Match: XP_022972014.1 (rho GDP-dissociation inhibitor 1-like isoform X1 [Cucurbita maxima]) HSP 1 Score: 165.6 bits (418), Expect = 8.6e-38 Identity = 88/93 (94.62%), Postives = 88/93 (94.62%), Query Frame = 0
BLAST of Carg15469 vs. NCBI nr
Match: XP_022145189.1 (rho GDP-dissociation inhibitor 1-like [Momordica charantia]) HSP 1 Score: 137.1 bits (344), Expect = 3.3e-29 Identity = 74/94 (78.72%), Postives = 86/94 (91.49%), Query Frame = 0
BLAST of Carg15469 vs. NCBI nr
Match: XP_004152300.1 (PREDICTED: rho GDP-dissociation inhibitor 1-like [Cucumis sativus] >KGN53053.1 hypothetical protein Csa_4G012490 [Cucumis sativus]) HSP 1 Score: 127.1 bits (318), Expect = 3.4e-26 Identity = 73/95 (76.84%), Postives = 81/95 (85.26%), Query Frame = 0
BLAST of Carg15469 vs. TAIR10
Match: AT3G07880.1 (Immunoglobulin E-set superfamily protein) HSP 1 Score: 65.5 bits (158), Expect = 2.2e-11 Identity = 30/40 (75.00%), Postives = 37/40 (92.50%), Query Frame = 0
BLAST of Carg15469 vs. TAIR10
Match: AT1G12070.1 (Immunoglobulin E-set superfamily protein) HSP 1 Score: 65.1 bits (157), Expect = 2.9e-11 Identity = 29/39 (74.36%), Postives = 35/39 (89.74%), Query Frame = 0
BLAST of Carg15469 vs. TAIR10
Match: AT1G62450.1 (Immunoglobulin E-set superfamily protein) HSP 1 Score: 61.6 bits (148), Expect = 3.2e-10 Identity = 32/70 (45.71%), Postives = 46/70 (65.71%), Query Frame = 0
BLAST of Carg15469 vs. Swiss-Prot
Match: sp|Q9SFC6|GDIR_ARATH (Rho GDP-dissociation inhibitor 1 OS=Arabidopsis thaliana OX=3702 GN=GDI1 PE=1 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 4.0e-10 Identity = 30/40 (75.00%), Postives = 37/40 (92.50%), Query Frame = 0
BLAST of Carg15469 vs. TrEMBL
Match: tr|A0A0A0KU57|A0A0A0KU57_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G012490 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 2.2e-26 Identity = 73/95 (76.84%), Postives = 81/95 (85.26%), Query Frame = 0
BLAST of Carg15469 vs. TrEMBL
Match: tr|A0A1S3BYU4|A0A1S3BYU4_CUCME (rho GDP-dissociation inhibitor 1-like OS=Cucumis melo OX=3656 GN=LOC103494555 PE=4 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 3.7e-21 Identity = 67/95 (70.53%), Postives = 72/95 (75.79%), Query Frame = 0
BLAST of Carg15469 vs. TrEMBL
Match: tr|A0A2I4HVF9|A0A2I4HVF9_9ROSI (rho GDP-dissociation inhibitor 1-like isoform X1 OS=Juglans regia OX=51240 GN=LOC109021847 PE=4 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 1.1e-17 Identity = 60/112 (53.57%), Postives = 75/112 (66.96%), Query Frame = 0
BLAST of Carg15469 vs. TrEMBL
Match: tr|A0A2I4HVF2|A0A2I4HVF2_9ROSI (rho GDP-dissociation inhibitor 1-like isoform X2 OS=Juglans regia OX=51240 GN=LOC109021847 PE=4 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 2.5e-17 Identity = 60/114 (52.63%), Postives = 75/114 (65.79%), Query Frame = 0
BLAST of Carg15469 vs. TrEMBL
Match: tr|A0A1S2YGC5|A0A1S2YGC5_CICAR (rho GDP-dissociation inhibitor 1-like OS=Cicer arietinum OX=3827 GN=LOC101502372 PE=4 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 6.8e-15 Identity = 58/110 (52.73%), Postives = 73/110 (66.36%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|