Carg14748 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGCTAGTTGATCCAAGGTTAGGCCCCAACTTCAACAAGGGAGAGGCATTGAGAATGATAAAAATTGCTCTCCATTGCACTAATATCTCTCCTGCAGCAAGACCTAACATGTCATCAGTAGTGAGCATGCTGGAAGGCAAGCAGGATATTGAGGGCATAGTGTTGGATTCTAGTGTCACTAAAGGATCAATAAACACAGCATGGACTCGTTTATTGGAGGACGCTGAGCAATCGAAGTACGGTTTGTTTGGCGATGTCTCGGCAACAGGTTCTTCTACATCTGCAGTCGATCTCTATCCGATTAACGTATCTCAGTACTTGAATATTAGAGAAACTAGACCATGA ATGGAGCTAGTTGATCCAAGGTTAGGCCCCAACTTCAACAAGGGAGAGGCATTGAGAATGATAAAAATTGCTCTCCATTGCACTAATATCTCTCCTGCAGCAAGACCTAACATGTCATCAGTAGTGAGCATGCTGGAAGGCAAGCAGGATATTGAGGGCATAGTGTTGGATTCTAGTGTCACTAAAGGATCAATAAACACAGCATGGACTCGTTTATTGGAGGACGCTGAGCAATCGAAGTACGGTTTGTTTGGCGATGTCTCGGCAACAGGTTCTTCTACATCTGCAGTCGATCTCTATCCGATTAACGTATCTCAGTACTTGAATATTAGAGAAACTAGACCATGA ATGGAGCTAGTTGATCCAAGGTTAGGCCCCAACTTCAACAAGGGAGAGGCATTGAGAATGATAAAAATTGCTCTCCATTGCACTAATATCTCTCCTGCAGCAAGACCTAACATGTCATCAGTAGTGAGCATGCTGGAAGGCAAGCAGGATATTGAGGGCATAGTGTTGGATTCTAGTGTCACTAAAGGATCAATAAACACAGCATGGACTCGTTTATTGGAGGACGCTGAGCAATCGAAGTACGGTTTGTTTGGCGATGTCTCGGCAACAGGTTCTTCTACATCTGCAGTCGATCTCTATCCGATTAACGTATCTCAGTACTTGAATATTAGAGAAACTAGACCATGA MELVDPRLGPNFNKGEALRMIKIALHCTNISPAARPNMSSVVSMLEGKQDIEGIVLDSSVTKGSINTAWTRLLEDAEQSKYGLFGDVSATGSSTSAVDLYPINVSQYLNIRETRP
BLAST of Carg14748 vs. NCBI nr
Match: XP_022941244.1 (probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 [Cucurbita moschata]) HSP 1 Score: 229.9 bits (585), Expect = 4.2e-57 Identity = 115/115 (100.00%), Postives = 115/115 (100.00%), Query Frame = 0
BLAST of Carg14748 vs. NCBI nr
Match: XP_022981274.1 (probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 [Cucurbita maxima]) HSP 1 Score: 220.3 bits (560), Expect = 3.3e-54 Identity = 110/115 (95.65%), Postives = 112/115 (97.39%), Query Frame = 0
BLAST of Carg14748 vs. NCBI nr
Match: XP_023524698.1 (probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 216.5 bits (550), Expect = 4.8e-53 Identity = 109/115 (94.78%), Postives = 110/115 (95.65%), Query Frame = 0
BLAST of Carg14748 vs. NCBI nr
Match: XP_008463778.1 (PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 [Cucumis melo]) HSP 1 Score: 171.4 bits (433), Expect = 1.8e-39 Identity = 87/118 (73.73%), Postives = 100/118 (84.75%), Query Frame = 0
BLAST of Carg14748 vs. NCBI nr
Match: XP_011654408.1 (PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 [Cucumis sativus]) HSP 1 Score: 168.3 bits (425), Expect = 1.5e-38 Identity = 87/118 (73.73%), Postives = 97/118 (82.20%), Query Frame = 0
BLAST of Carg14748 vs. TAIR10
Match: AT1G29740.1 (Leucine-rich repeat transmembrane protein kinase) HSP 1 Score: 71.2 bits (173), Expect = 4.6e-13 Identity = 45/107 (42.06%), Postives = 60/107 (56.07%), Query Frame = 0
BLAST of Carg14748 vs. TAIR10
Match: AT3G14840.2 (Leucine-rich repeat transmembrane protein kinase) HSP 1 Score: 71.2 bits (173), Expect = 4.6e-13 Identity = 45/125 (36.00%), Postives = 67/125 (53.60%), Query Frame = 0
BLAST of Carg14748 vs. TAIR10
Match: AT1G29730.1 (Leucine-rich repeat transmembrane protein kinase) HSP 1 Score: 70.9 bits (172), Expect = 6.0e-13 Identity = 43/102 (42.16%), Postives = 58/102 (56.86%), Query Frame = 0
BLAST of Carg14748 vs. TAIR10
Match: AT1G29720.1 (Leucine-rich repeat transmembrane protein kinase) HSP 1 Score: 70.9 bits (172), Expect = 6.0e-13 Identity = 41/104 (39.42%), Postives = 58/104 (55.77%), Query Frame = 0
BLAST of Carg14748 vs. TAIR10
Match: AT1G53430.1 (Leucine-rich repeat transmembrane protein kinase) HSP 1 Score: 69.7 bits (169), Expect = 1.3e-12 Identity = 34/52 (65.38%), Postives = 41/52 (78.85%), Query Frame = 0
BLAST of Carg14748 vs. Swiss-Prot
Match: sp|C0LGN2|Y3148_ARATH (Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 OS=Arabidopsis thaliana OX=3702 GN=LRR-RLK PE=1 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 8.2e-12 Identity = 45/125 (36.00%), Postives = 67/125 (53.60%), Query Frame = 0
BLAST of Carg14748 vs. Swiss-Prot
Match: sp|Q9ASQ6|Y1972_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g29720 OS=Arabidopsis thaliana OX=3702 GN=RFK1 PE=2 SV=3) HSP 1 Score: 70.9 bits (172), Expect = 1.1e-11 Identity = 41/104 (39.42%), Postives = 58/104 (55.77%), Query Frame = 0
BLAST of Carg14748 vs. Swiss-Prot
Match: sp|C0LGG8|Y5343_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g53430 OS=Arabidopsis thaliana OX=3702 GN=At1g53430 PE=1 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 2.4e-11 Identity = 34/52 (65.38%), Postives = 41/52 (78.85%), Query Frame = 0
BLAST of Carg14748 vs. Swiss-Prot
Match: sp|C0LGG9|Y5344_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g53440 OS=Arabidopsis thaliana OX=3702 GN=At1g53440 PE=2 SV=2) HSP 1 Score: 68.6 bits (166), Expect = 5.3e-11 Identity = 33/52 (63.46%), Postives = 41/52 (78.85%), Query Frame = 0
BLAST of Carg14748 vs. Swiss-Prot
Match: sp|C0LGE0|Y1765_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g07650 OS=Arabidopsis thaliana OX=3702 GN=At1g07650 PE=1 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.7e-09 Identity = 34/98 (34.69%), Postives = 57/98 (58.16%), Query Frame = 0
BLAST of Carg14748 vs. TrEMBL
Match: tr|A0A1S3CK33|A0A1S3CK33_CUCME (probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 OS=Cucumis melo OX=3656 GN=LOC103501841 PE=4 SV=1) HSP 1 Score: 171.4 bits (433), Expect = 1.2e-39 Identity = 87/118 (73.73%), Postives = 100/118 (84.75%), Query Frame = 0
BLAST of Carg14748 vs. TrEMBL
Match: tr|A0A0A0L4I8|A0A0A0L4I8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G623390 PE=4 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 9.4e-29 Identity = 71/99 (71.72%), Postives = 80/99 (80.81%), Query Frame = 0
BLAST of Carg14748 vs. TrEMBL
Match: tr|A0A1S3CK28|A0A1S3CK28_CUCME (probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 OS=Cucumis melo OX=3656 GN=LOC103501833 PE=4 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 1.4e-19 Identity = 58/117 (49.57%), Postives = 76/117 (64.96%), Query Frame = 0
BLAST of Carg14748 vs. TrEMBL
Match: tr|A0A2H5Q584|A0A2H5Q584_CITUN (Uncharacterized protein OS=Citrus unshiu OX=55188 GN=CUMW_196620 PE=4 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 1.3e-17 Identity = 60/121 (49.59%), Postives = 75/121 (61.98%), Query Frame = 0
BLAST of Carg14748 vs. TrEMBL
Match: tr|A0A2H5Q532|A0A2H5Q532_CITUN (Uncharacterized protein OS=Citrus unshiu OX=55188 GN=CUMW_196620 PE=4 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 1.3e-17 Identity = 60/121 (49.59%), Postives = 75/121 (61.98%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|