Carg13249 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexonthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTAGTATAATTAACTACAATATTGGTTTCAGTGGTGACACTGATGGAAATGTACCCATTACTTCCACCAAAGACTATCGCCACGATGAAGCTTTCGGTCAAGAAACCTTGGTACCCCTGGTTCGTTCATCATGAGGTACGTTCTTGTAACTCTATTTCCTTATTAAAATAAACGAGTATTTAATTTAAGCTCACTTAGATCGTCTTAATTAATCTCAATTTTAATTTTGACGTTGAATTTATAGGTCGGAGGGTATGCAGAAGTGTATGAAGGGGAGTTGACGTTGGCGACCGTGAGAGGGGCATGTCATGAAGTGCCAAGCTTCCAACCAAGAAGAGCCCTTGCACTTATCACACACTTCCTTGAAGGGACTTCTCTCCCGCCCTCTTCTCCTTCGTCTCATTCTTCATAACATTTTTTCCATATGTAATTTTAACTTTCCATTAATCTTTTTTAAATTAGGTTCTTCTTATATACCTCCAATGTCAATATGTAATACTAATACCTATAATCGGAATGAATAATAAACCGTTAACATTCTTGATCTCAAGTGATTATGTCTGTTTTTAATTTTTTTTATTCAAATTAATTCACACATGGCTCAATGTTAAAAGTTTGATTTTCCATCTTGTTATTATT ATGAGTAGTATAATTAACTACAATATTGGTTTCAGTGGTGACACTGATGGAAATGTACCCATTACTTCCACCAAAGACTATCGCCACGATGAAGCTTTCGGTCAAGAAACCTTGGTACCCCTGGTCGGAGGGTATGCAGAAGTGTATGAAGGGGAGTTGACGTTGGCGACCGTGAGAGGGGCATGTCATGAAGTGCCAAGCTTCCAACCAAGAAGAGCCCTTGCACTTATCACACACTTCCTTGAAGGGACTTCTCTCCCGCCCTCTTCTCCTTCGTCTCATTCTTCATAACATTTTTTCCATATAATAATAAACCGTTAACATTCTTGATCTCAAGTGATTATGTCTGTTTTTAATTTTTTTTATTCAAATTAATTCACACATGGCTCAATGTTAAAAGTTTGATTTTCCATCTTGTTATTATT ATGAGTAGTATAATTAACTACAATATTGGTTTCAGTGGTGACACTGATGGAAATGTACCCATTACTTCCACCAAAGACTATCGCCACGATGAAGCTTTCGGTCAAGAAACCTTGGTACCCCTGGTCGGAGGGTATGCAGAAGTGTATGAAGGGGAGTTGACGTTGGCGACCGTGAGAGGGGCATGTCATGAAGTGCCAAGCTTCCAACCAAGAAGAGCCCTTGCACTTATCACACACTTCCTTGAAGGGACTTCTCTCCCGCCCTCTTCTCCTTCGTCTCATTCTTCATAA MSSIINYNIGFSGDTDGNVPITSTKDYRHDEAFGQETLVPLVGGYAEVYEGELTLATVRGACHEVPSFQPRRALALITHFLEGTSLPPSSPSSHSS
BLAST of Carg13249 vs. NCBI nr
Match: XP_022931868.1 (serine carboxypeptidase-like 40 [Cucurbita moschata]) HSP 1 Score: 127.5 bits (319), Expect = 2.5e-26 Identity = 71/92 (77.17%), Postives = 73/92 (79.35%), Query Frame = 0
BLAST of Carg13249 vs. NCBI nr
Match: XP_022953331.1 (serine carboxypeptidase-like 40 [Cucurbita moschata]) HSP 1 Score: 111.3 bits (277), Expect = 1.8e-21 Identity = 61/91 (67.03%), Postives = 69/91 (75.82%), Query Frame = 0
BLAST of Carg13249 vs. NCBI nr
Match: XP_023549388.1 (serine carboxypeptidase-like 40 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 109.8 bits (273), Expect = 5.3e-21 Identity = 60/91 (65.93%), Postives = 68/91 (74.73%), Query Frame = 0
BLAST of Carg13249 vs. NCBI nr
Match: XP_022960482.1 (serine carboxypeptidase-like 40 [Cucurbita moschata]) HSP 1 Score: 104.8 bits (260), Expect = 1.7e-19 Identity = 59/90 (65.56%), Postives = 64/90 (71.11%), Query Frame = 0
BLAST of Carg13249 vs. NCBI nr
Match: XP_023004522.1 (serine carboxypeptidase-like 40 [Cucurbita maxima]) HSP 1 Score: 104.8 bits (260), Expect = 1.7e-19 Identity = 59/90 (65.56%), Postives = 64/90 (71.11%), Query Frame = 0
BLAST of Carg13249 vs. TAIR10
Match: AT3G63470.1 (serine carboxypeptidase-like 40) HSP 1 Score: 86.3 bits (212), Expect = 1.1e-17 Identity = 46/86 (53.49%), Postives = 57/86 (66.28%), Query Frame = 0
BLAST of Carg13249 vs. TAIR10
Match: AT4G30610.1 (alpha/beta-Hydrolases superfamily protein) HSP 1 Score: 68.9 bits (167), Expect = 1.9e-12 Identity = 43/85 (50.59%), Postives = 51/85 (60.00%), Query Frame = 0
BLAST of Carg13249 vs. TAIR10
Match: AT2G24010.1 (serine carboxypeptidase-like 23) HSP 1 Score: 67.4 bits (163), Expect = 5.5e-12 Identity = 42/85 (49.41%), Postives = 48/85 (56.47%), Query Frame = 0
BLAST of Carg13249 vs. TAIR10
Match: AT2G33530.1 (serine carboxypeptidase-like 46) HSP 1 Score: 65.5 bits (158), Expect = 2.1e-11 Identity = 39/87 (44.83%), Postives = 46/87 (52.87%), Query Frame = 0
BLAST of Carg13249 vs. TAIR10
Match: AT3G02110.1 (serine carboxypeptidase-like 25) HSP 1 Score: 65.1 bits (157), Expect = 2.7e-11 Identity = 42/86 (48.84%), Postives = 49/86 (56.98%), Query Frame = 0
BLAST of Carg13249 vs. Swiss-Prot
Match: sp|Q0WRX3|SCP40_ARATH (Serine carboxypeptidase-like 40 OS=Arabidopsis thaliana OX=3702 GN=SCPL40 PE=2 SV=2) HSP 1 Score: 86.3 bits (212), Expect = 2.1e-16 Identity = 46/86 (53.49%), Postives = 57/86 (66.28%), Query Frame = 0
BLAST of Carg13249 vs. Swiss-Prot
Match: sp|P52711|CBP23_HORVU (Serine carboxypeptidase II-3 OS=Hordeum vulgare OX=4513 GN=CXP;2-3 PE=2 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 2.8e-13 Identity = 41/87 (47.13%), Postives = 53/87 (60.92%), Query Frame = 0
BLAST of Carg13249 vs. Swiss-Prot
Match: sp|Q9M099|SCP24_ARATH (Serine carboxypeptidase 24 OS=Arabidopsis thaliana OX=3702 GN=SCPL24 PE=1 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 3.4e-11 Identity = 43/85 (50.59%), Postives = 51/85 (60.00%), Query Frame = 0
BLAST of Carg13249 vs. Swiss-Prot
Match: sp|O82229|SCP23_ARATH (Putative serine carboxypeptidase-like 23 OS=Arabidopsis thaliana OX=3702 GN=SCPL23 PE=2 SV=2) HSP 1 Score: 67.4 bits (163), Expect = 9.9e-11 Identity = 42/85 (49.41%), Postives = 48/85 (56.47%), Query Frame = 0
BLAST of Carg13249 vs. Swiss-Prot
Match: sp|Q8VY01|SCP46_ARATH (Serine carboxypeptidase-like 46 OS=Arabidopsis thaliana OX=3702 GN=SCPL46 PE=2 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 3.8e-10 Identity = 39/87 (44.83%), Postives = 46/87 (52.87%), Query Frame = 0
BLAST of Carg13249 vs. TrEMBL
Match: tr|A0A1S3CEI2|A0A1S3CEI2_CUCME (Carboxypeptidase OS=Cucumis melo OX=3656 GN=LOC103499959 PE=3 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 2.4e-17 Identity = 56/86 (65.12%), Postives = 61/86 (70.93%), Query Frame = 0
BLAST of Carg13249 vs. TrEMBL
Match: tr|A0A0A0K5Z0|A0A0A0K5Z0_CUCSA (Carboxypeptidase OS=Cucumis sativus OX=3659 GN=Csa_7G420830 PE=3 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 2.4e-17 Identity = 57/86 (66.28%), Postives = 63/86 (73.26%), Query Frame = 0
BLAST of Carg13249 vs. TrEMBL
Match: tr|A0A059BJ04|A0A059BJ04_EUCGR (Carboxypeptidase OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_G03295 PE=3 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 9.0e-17 Identity = 50/85 (58.82%), Postives = 59/85 (69.41%), Query Frame = 0
BLAST of Carg13249 vs. TrEMBL
Match: tr|A0A2P5EH16|A0A2P5EH16_9ROSA (Carboxypeptidase OS=Trema orientalis OX=63057 GN=TorSCPL27 PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 9.9e-16 Identity = 50/91 (54.95%), Postives = 60/91 (65.93%), Query Frame = 0
BLAST of Carg13249 vs. TrEMBL
Match: tr|A0A0B0P8Z5|A0A0B0P8Z5_GOSAR (Carboxypeptidase OS=Gossypium arboreum OX=29729 GN=F383_01719 PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 9.9e-16 Identity = 48/83 (57.83%), Postives = 57/83 (68.67%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |