Carg12228 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTCCTCCAGAAACTTATGTAGCGAGAAATCTTCTTAGAGATCTTGGAGGAAAACCTGCTTCACAAAGACATGTTCATGCCTTTTATGGTGGGAATATGCATGGTTATGTCTTAACCCTGATATGAAGATCTTTGGTCCAATGCCTCATTGCAATGCAACCAAAATGATTACATTCAGCATATGAAGAGCAGCAAATACTGCATCTGCCCAAAGGGTTACGAGCTCAATAGTCCACGGGTTGTGGAAGCCATGTTTTATGAGTGTGTACCTGTGATCATATCAGACAATTTCGTACCACCATTTTTAGAGGTGTTGAATTGGGAAGCATTTTCAGTGATTGTTGCAGAAAAGGATATTCCATACTTACAACAACATACTGCTTTCTTTCAATACTAA ATGTCTCCTCCAGAAACTTATGTAGCGAGAAATCTTCTTAGAGATCTTGGAGGAAAACCTGCTTCACAAAGACATGTTCATGCCTTTTATGGTGGGAATATGCATGATCTTTGGTCCAATGCCTCATTGCAATGCAACCAAAATGATTACATTCAGCATATGAAGAGCAGCAAATACTGCATCTGCCCAAAGGGTTACGAGCTCAATAGTCCACGGGTTGTGGAAGCCATGTTTTATGAGTGTGTACCTGTGATCATATCAGACAATTTCGTACCACCATTTTTAGAGGTGTTGAATTGGGAAGCATTTTCAGTGATTGTTGCAGAAAAGGATATTCCATACTTACAACAACATACTGCTTTCTTTCAATACTAA ATGTCTCCTCCAGAAACTTATGTAGCGAGAAATCTTCTTAGAGATCTTGGAGGAAAACCTGCTTCACAAAGACATGTTCATGCCTTTTATGGTGGGAATATGCATGATCTTTGGTCCAATGCCTCATTGCAATGCAACCAAAATGATTACATTCAGCATATGAAGAGCAGCAAATACTGCATCTGCCCAAAGGGTTACGAGCTCAATAGTCCACGGGTTGTGGAAGCCATGTTTTATGAGTGTGTACCTGTGATCATATCAGACAATTTCGTACCACCATTTTTAGAGGTGTTGAATTGGGAAGCATTTTCAGTGATTGTTGCAGAAAAGGATATTCCATACTTACAACAACATACTGCTTTCTTTCAATACTAA MSPPETYVARNLLRDLGGKPASQRHVHAFYGGNMHDLWSNASLQCNQNDYIQHMKSSKYCICPKGYELNSPRVVEAMFYECVPVIISDNFVPPFLEVLNWEAFSVIVAEKDIPYLQQHTAFFQY
BLAST of Carg12228 vs. NCBI nr
Match: XP_022961026.1 (probable glycosyltransferase At5g03795 [Cucurbita moschata]) HSP 1 Score: 178.7 bits (452), Expect = 1.2e-41 Identity = 92/137 (67.15%), Postives = 103/137 (75.18%), Query Frame = 0
BLAST of Carg12228 vs. NCBI nr
Match: XP_022987636.1 (probable glycosyltransferase At5g03795 [Cucurbita maxima]) HSP 1 Score: 178.7 bits (452), Expect = 1.2e-41 Identity = 92/137 (67.15%), Postives = 103/137 (75.18%), Query Frame = 0
BLAST of Carg12228 vs. NCBI nr
Match: XP_023516188.1 (probable glycosyltransferase At5g03795 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 178.7 bits (452), Expect = 1.2e-41 Identity = 92/137 (67.15%), Postives = 103/137 (75.18%), Query Frame = 0
BLAST of Carg12228 vs. NCBI nr
Match: XP_004148727.1 (PREDICTED: probable glycosyltransferase At5g03795 [Cucumis sativus] >KGN65348.1 hypothetical protein Csa_1G364960 [Cucumis sativus]) HSP 1 Score: 177.2 bits (448), Expect = 3.5e-41 Identity = 92/137 (67.15%), Postives = 102/137 (74.45%), Query Frame = 0
BLAST of Carg12228 vs. NCBI nr
Match: XP_008462761.1 (PREDICTED: probable glycosyltransferase At5g03795 [Cucumis melo]) HSP 1 Score: 177.2 bits (448), Expect = 3.5e-41 Identity = 92/137 (67.15%), Postives = 102/137 (74.45%), Query Frame = 0
BLAST of Carg12228 vs. TAIR10
Match: AT5G19670.1 (Exostosin family protein) HSP 1 Score: 161.0 bits (406), Expect = 4.7e-40 Identity = 84/137 (61.31%), Postives = 96/137 (70.07%), Query Frame = 0
BLAST of Carg12228 vs. TAIR10
Match: AT4G32790.1 (Exostosin family protein) HSP 1 Score: 146.7 bits (369), Expect = 9.2e-36 Identity = 75/134 (55.97%), Postives = 89/134 (66.42%), Query Frame = 0
BLAST of Carg12228 vs. TAIR10
Match: AT5G25820.1 (Exostosin family protein) HSP 1 Score: 131.0 bits (328), Expect = 5.2e-31 Identity = 69/139 (49.64%), Postives = 91/139 (65.47%), Query Frame = 0
BLAST of Carg12228 vs. TAIR10
Match: AT4G16745.2 (Exostosin family protein) HSP 1 Score: 127.1 bits (318), Expect = 7.5e-30 Identity = 66/139 (47.48%), Postives = 89/139 (64.03%), Query Frame = 0
BLAST of Carg12228 vs. TAIR10
Match: AT5G11610.1 (Exostosin family protein) HSP 1 Score: 125.6 bits (314), Expect = 2.2e-29 Identity = 64/134 (47.76%), Postives = 90/134 (67.16%), Query Frame = 0
BLAST of Carg12228 vs. Swiss-Prot
Match: sp|Q9FFN2|GLYT3_ARATH (Probable glycosyltransferase At5g03795 OS=Arabidopsis thaliana OX=3702 GN=At5g03795 PE=3 SV=2) HSP 1 Score: 102.1 bits (253), Expect = 4.7e-21 Identity = 54/132 (40.91%), Postives = 76/132 (57.58%), Query Frame = 0
BLAST of Carg12228 vs. Swiss-Prot
Match: sp|Q3E7Q9|GLYT6_ARATH (Probable glycosyltransferase At5g25310 OS=Arabidopsis thaliana OX=3702 GN=At5g25310 PE=3 SV=2) HSP 1 Score: 92.0 bits (227), Expect = 4.8e-18 Identity = 39/69 (56.52%), Postives = 53/69 (76.81%), Query Frame = 0
BLAST of Carg12228 vs. Swiss-Prot
Match: sp|Q9SSE8|GLYT1_ARATH (Probable glycosyltransferase At3g07620 OS=Arabidopsis thaliana OX=3702 GN=At3g07620 PE=3 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.4e-17 Identity = 39/69 (56.52%), Postives = 55/69 (79.71%), Query Frame = 0
BLAST of Carg12228 vs. Swiss-Prot
Match: sp|Q94AA9|XGD1_ARATH (Xylogalacturonan beta-1,3-xylosyltransferase OS=Arabidopsis thaliana OX=3702 GN=XGD1 PE=1 SV=2) HSP 1 Score: 84.0 bits (206), Expect = 1.3e-15 Identity = 51/143 (35.66%), Postives = 76/143 (53.15%), Query Frame = 0
BLAST of Carg12228 vs. Swiss-Prot
Match: sp|Q9LFP3|GLYT4_ARATH (Probable glycosyltransferase At5g11130 OS=Arabidopsis thaliana OX=3702 GN=At5g11130/At5g11120 PE=3 SV=2) HSP 1 Score: 79.7 bits (195), Expect = 2.5e-14 Identity = 41/116 (35.34%), Postives = 65/116 (56.03%), Query Frame = 0
BLAST of Carg12228 vs. TrEMBL
Match: tr|A0A1S3CJA3|A0A1S3CJA3_CUCME (probable glycosyltransferase At5g03795 OS=Cucumis melo OX=3656 GN=LOC103501046 PE=4 SV=1) HSP 1 Score: 177.2 bits (448), Expect = 2.3e-41 Identity = 92/137 (67.15%), Postives = 102/137 (74.45%), Query Frame = 0
BLAST of Carg12228 vs. TrEMBL
Match: tr|A0A0A0LU64|A0A0A0LU64_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G364960 PE=4 SV=1) HSP 1 Score: 177.2 bits (448), Expect = 2.3e-41 Identity = 92/137 (67.15%), Postives = 102/137 (74.45%), Query Frame = 0
BLAST of Carg12228 vs. TrEMBL
Match: tr|A0A103XNN0|A0A103XNN0_CYNCS (Exostosin-like protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_004053 PE=4 SV=1) HSP 1 Score: 174.9 bits (442), Expect = 1.2e-40 Identity = 88/138 (63.77%), Postives = 103/138 (74.64%), Query Frame = 0
BLAST of Carg12228 vs. TrEMBL
Match: tr|A0A2G9H8M8|A0A2G9H8M8_9LAMI (Acetylglucosaminyltransferase EXT1/exostosin 1 OS=Handroanthus impetiginosus OX=429701 GN=CDL12_13711 PE=4 SV=1) HSP 1 Score: 172.2 bits (435), Expect = 7.5e-40 Identity = 87/137 (63.50%), Postives = 100/137 (72.99%), Query Frame = 0
BLAST of Carg12228 vs. TrEMBL
Match: tr|A0A2G9G9F8|A0A2G9G9F8_9LAMI (Acetylglucosaminyltransferase EXT1/exostosin 1 OS=Handroanthus impetiginosus OX=429701 GN=CDL12_25568 PE=4 SV=1) HSP 1 Score: 172.2 bits (435), Expect = 7.5e-40 Identity = 87/137 (63.50%), Postives = 100/137 (72.99%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |