Carg11948 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGCGGCATCCAATGGAGAAACAACTCCGTCACTCCGCCCAAACCCACCGTCCTAATGGCCTCTCTGTTCTCGTCACCGGCGCTGCTGGCTTCGTCGGAACCCATGTTTCCCTCGCTTTGAAGAACGCGGCGACGGCGTTGTCGGCCTTGATAATTTCAATTCCTATTATGACCCTTCCTTTGAAAAAAAGCCCGGAAATCGCTTCTCTCCGATCCACGGAATCTTCGTCGTTCACGGCGATTAAACGACGCTAG ATGGGGCGGCATCCAATGGAGAAACAACTCCGTCACTCCGCCCAAACCCACCGTCCTAATGGCCTCTCTGTTCTCGTCACCGGCGCTGCTGGCTTCGTCGGAACCCATGTTTCCCTCGCTTTGAAGAACGCGGCGACGGCGTTGTCGGCCTTGATAATTTCAATTCCTATTATGACCCTTCCTTTGAAAAAAAGCCCGGAAATCGCTTCTCTCCGATCCACGGAATCTTCGTCGTTCACGGCGATTAAACGACGCTAG ATGGGGCGGCATCCAATGGAGAAACAACTCCGTCACTCCGCCCAAACCCACCGTCCTAATGGCCTCTCTGTTCTCGTCACCGGCGCTGCTGGCTTCGTCGGAACCCATGTTTCCCTCGCTTTGAAGAACGCGGCGACGGCGTTGTCGGCCTTGATAATTTCAATTCCTATTATGACCCTTCCTTTGAAAAAAAGCCCGGAAATCGCTTCTCTCCGATCCACGGAATCTTCGTCGTTCACGGCGATTAAACGACGCTAG MGRHPMEKQLRHSAQTHRPNGLSVLVTGAAGFVGTHVSLALKNAATALSALIISIPIMTLPLKKSPEIASLRSTESSSFTAIKRR
BLAST of Carg11948 vs. NCBI nr
Match: XP_022946532.1 (UDP-glucuronate 4-epimerase 1 [Cucurbita moschata]) HSP 1 Score: 72.0 bits (175), Expect = 1.1e-09 Identity = 37/45 (82.22%), Postives = 38/45 (84.44%), Query Frame = 0
BLAST of Carg11948 vs. NCBI nr
Match: XP_022999693.1 (UDP-glucuronate 4-epimerase 1 [Cucurbita maxima]) HSP 1 Score: 72.0 bits (175), Expect = 1.1e-09 Identity = 37/45 (82.22%), Postives = 38/45 (84.44%), Query Frame = 0
BLAST of Carg11948 vs. NCBI nr
Match: XP_023547336.1 (UDP-glucuronate 4-epimerase 1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 72.0 bits (175), Expect = 1.1e-09 Identity = 37/45 (82.22%), Postives = 38/45 (84.44%), Query Frame = 0
BLAST of Carg11948 vs. NCBI nr
Match: XP_011010511.1 (PREDICTED: UDP-glucuronate 4-epimerase 1-like [Populus euphratica] >XP_011014870.1 PREDICTED: UDP-glucuronate 4-epimerase 1-like [Populus euphratica]) HSP 1 Score: 64.3 bits (155), Expect = 2.3e-07 Identity = 31/36 (86.11%), Postives = 34/36 (94.44%), Query Frame = 0
BLAST of Carg11948 vs. NCBI nr
Match: XP_002309376.1 (UDP-glucuronate 4-epimerase 1 [Populus trichocarpa] >PNT32262.1 hypothetical protein POPTR_006G178500v3 [Populus trichocarpa]) HSP 1 Score: 64.3 bits (155), Expect = 2.3e-07 Identity = 31/36 (86.11%), Postives = 34/36 (94.44%), Query Frame = 0
BLAST of Carg11948 vs. TAIR10
Match: AT4G30440.1 (UDP-D-glucuronate 4-epimerase 1) HSP 1 Score: 54.3 bits (129), Expect = 4.3e-08 Identity = 28/45 (62.22%), Postives = 33/45 (73.33%), Query Frame = 0
BLAST of Carg11948 vs. TAIR10
Match: AT3G23820.1 (UDP-D-glucuronate 4-epimerase 6) HSP 1 Score: 51.6 bits (122), Expect = 2.8e-07 Identity = 25/36 (69.44%), Postives = 31/36 (86.11%), Query Frame = 0
BLAST of Carg11948 vs. TAIR10
Match: AT1G02000.1 (UDP-D-glucuronate 4-epimerase 2) HSP 1 Score: 50.4 bits (119), Expect = 6.2e-07 Identity = 27/45 (60.00%), Postives = 32/45 (71.11%), Query Frame = 0
BLAST of Carg11948 vs. TAIR10
Match: AT4G12250.1 (UDP-D-glucuronate 4-epimerase 5) HSP 1 Score: 48.1 bits (113), Expect = 3.1e-06 Identity = 25/45 (55.56%), Postives = 32/45 (71.11%), Query Frame = 0
BLAST of Carg11948 vs. TAIR10
Match: AT2G45310.1 (UDP-D-glucuronate 4-epimerase 4) HSP 1 Score: 47.4 bits (111), Expect = 5.2e-06 Identity = 28/47 (59.57%), Postives = 33/47 (70.21%), Query Frame = 0
BLAST of Carg11948 vs. Swiss-Prot
Match: sp|Q9M0B6|GAE1_ARATH (UDP-glucuronate 4-epimerase 1 OS=Arabidopsis thaliana OX=3702 GN=GAE1 PE=1 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 7.7e-07 Identity = 28/45 (62.22%), Postives = 33/45 (73.33%), Query Frame = 0
BLAST of Carg11948 vs. Swiss-Prot
Match: sp|Q9LIS3|GAE6_ARATH (UDP-glucuronate 4-epimerase 6 OS=Arabidopsis thaliana OX=3702 GN=GAE6 PE=1 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 5.0e-06 Identity = 25/36 (69.44%), Postives = 31/36 (86.11%), Query Frame = 0
BLAST of Carg11948 vs. Swiss-Prot
Match: sp|Q9LPC1|GAE2_ARATH (UDP-glucuronate 4-epimerase 2 OS=Arabidopsis thaliana OX=3702 GN=GAE2 PE=2 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 1.1e-05 Identity = 27/45 (60.00%), Postives = 32/45 (71.11%), Query Frame = 0
BLAST of Carg11948 vs. Swiss-Prot
Match: sp|Q9STI6|GAE5_ARATH (UDP-glucuronate 4-epimerase 5 OS=Arabidopsis thaliana OX=3702 GN=GAE5 PE=2 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 5.5e-05 Identity = 25/45 (55.56%), Postives = 32/45 (71.11%), Query Frame = 0
BLAST of Carg11948 vs. Swiss-Prot
Match: sp|O81312|GAE3_ARATH (UDP-glucuronate 4-epimerase 3 OS=Arabidopsis thaliana OX=3702 GN=GAE3 PE=2 SV=1) HSP 1 Score: 47.4 bits (111), Expect = 9.4e-05 Identity = 26/45 (57.78%), Postives = 30/45 (66.67%), Query Frame = 0
BLAST of Carg11948 vs. TrEMBL
Match: tr|B9HBG7|B9HBG7_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_006G178500v3 PE=4 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.5e-07 Identity = 31/36 (86.11%), Postives = 34/36 (94.44%), Query Frame = 0
BLAST of Carg11948 vs. TrEMBL
Match: tr|A0A1S4C9G8|A0A1S4C9G8_TOBAC (UDP-glucuronate 4-epimerase 1-like OS=Nicotiana tabacum OX=4097 GN=LOC107816401 PE=4 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 5.7e-07 Identity = 33/50 (66.00%), Postives = 37/50 (74.00%), Query Frame = 0
BLAST of Carg11948 vs. TrEMBL
Match: tr|A0A1S4AYQ3|A0A1S4AYQ3_TOBAC (UDP-glucuronate 4-epimerase 1 OS=Nicotiana tabacum OX=4097 GN=LOC107802630 PE=4 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 5.7e-07 Identity = 33/50 (66.00%), Postives = 37/50 (74.00%), Query Frame = 0
BLAST of Carg11948 vs. TrEMBL
Match: tr|A0A1U7YAK9|A0A1U7YAK9_NICSY (UDP-glucuronate 4-epimerase 1 OS=Nicotiana sylvestris OX=4096 GN=LOC104246106 PE=4 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 5.7e-07 Identity = 33/50 (66.00%), Postives = 37/50 (74.00%), Query Frame = 0
BLAST of Carg11948 vs. TrEMBL
Match: tr|A0A059CNX7|A0A059CNX7_EUCGR (Uncharacterized protein OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_C01241 PE=4 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 7.5e-07 Identity = 32/45 (71.11%), Postives = 36/45 (80.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: None |