Carg11076 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTTCTCTCTCTGTCTCAATTCTTCCCTTCTTGTTCTTCCTCTTCTCCAATTTTGCCATCACTCAATCTTCCATTTCCAACACATCCTCCCTCATCTACAACACTTGCAAGACCAGCTCCGATCAAGACCCCAACATCTCCTTCAATTTCTGCCTAACATCTCTCCAACACGGGGCGGAGCATGGCCGCGGCGCCCTCGATCTCCGCCGCCTCGGCCTCATCTCCCTTCGCTTGGTTCGCCGTAACGTGAGCAGCACACGCCACTATATCAAGAAGTTGCGAAGAAATAAGCACCTCAACACGTTGGTTAAGTCCTGTTTAACTGATTGTTTGGAGCTTTATTCTGATGCCATCCCAACACTTAAGGATGCTCGAAGGGATTATAAGGGTAGACGTTACTTCGAGACGAACTTGAAGATCAGCTCGGTTATGGATGATTGTTCGACTTGTGAAGACGGATTCGAGGAAGAAGGTGTGATTTCACCGTTGACTAATAGGAGTTATAATGCTTTTGAATTATCAGCTATTGCACTCTCCATTATTAATATGCTTTCTTGA ATGTCTTCTCTCTCTGTCTCAATTCTTCCCTTCTTGTTCTTCCTCTTCTCCAATTTTGCCATCACTCAATCTTCCATTTCCAACACATCCTCCCTCATCTACAACACTTGCAAGACCAGCTCCGATCAAGACCCCAACATCTCCTTCAATTTCTGCCTAACATCTCTCCAACACGGGGCGGAGCATGGCCGCGGCGCCCTCGATCTCCGCCGCCTCGGCCTCATCTCCCTTCGCTTGGTTCGCCGTAACGTGAGCAGCACACGCCACTATATCAAGAAGTTGCGAAGAAATAAGCACCTCAACACGTTGGTTAAGTCCTGTTTAACTGATTGTTTGGAGCTTTATTCTGATGCCATCCCAACACTTAAGGATGCTCGAAGGGATTATAAGGGTAGACGTTACTTCGAGACGAACTTGAAGATCAGCTCGGTTATGGATGATTGTTCGACTTGTGAAGACGGATTCGAGGAAGAAGGTGTGATTTCACCGTTGACTAATAGGAGTTATAATGCTTTTGAATTATCAGCTATTGCACTCTCCATTATTAATATGCTTTCTTGA ATGTCTTCTCTCTCTGTCTCAATTCTTCCCTTCTTGTTCTTCCTCTTCTCCAATTTTGCCATCACTCAATCTTCCATTTCCAACACATCCTCCCTCATCTACAACACTTGCAAGACCAGCTCCGATCAAGACCCCAACATCTCCTTCAATTTCTGCCTAACATCTCTCCAACACGGGGCGGAGCATGGCCGCGGCGCCCTCGATCTCCGCCGCCTCGGCCTCATCTCCCTTCGCTTGGTTCGCCGTAACGTGAGCAGCACACGCCACTATATCAAGAAGTTGCGAAGAAATAAGCACCTCAACACGTTGGTTAAGTCCTGTTTAACTGATTGTTTGGAGCTTTATTCTGATGCCATCCCAACACTTAAGGATGCTCGAAGGGATTATAAGGGTAGACGTTACTTCGAGACGAACTTGAAGATCAGCTCGGTTATGGATGATTGTTCGACTTGTGAAGACGGATTCGAGGAAGAAGGTGTGATTTCACCGTTGACTAATAGGAGTTATAATGCTTTTGAATTATCAGCTATTGCACTCTCCATTATTAATATGCTTTCTTGA MSSLSVSILPFLFFLFSNFAITQSSISNTSSLIYNTCKTSSDQDPNISFNFCLTSLQHGAEHGRGALDLRRLGLISLRLVRRNVSSTRHYIKKLRRNKHLNTLVKSCLTDCLELYSDAIPTLKDARRDYKGRRYFETNLKISSVMDDCSTCEDGFEEEGVISPLTNRSYNAFELSAIALSIINMLS
BLAST of Carg11076 vs. NCBI nr
Match: XP_022964388.1 (putative invertase inhibitor [Cucurbita moschata]) HSP 1 Score: 359.4 bits (921), Expect = 7.5e-96 Identity = 186/186 (100.00%), Postives = 186/186 (100.00%), Query Frame = 0
BLAST of Carg11076 vs. NCBI nr
Match: XP_023514422.1 (putative invertase inhibitor [Cucurbita pepo subsp. pepo]) HSP 1 Score: 335.5 bits (859), Expect = 1.2e-88 Identity = 176/190 (92.63%), Postives = 182/190 (95.79%), Query Frame = 0
BLAST of Carg11076 vs. NCBI nr
Match: XP_022999944.1 (putative invertase inhibitor [Cucurbita maxima]) HSP 1 Score: 327.8 bits (839), Expect = 2.4e-86 Identity = 173/190 (91.05%), Postives = 178/190 (93.68%), Query Frame = 0
BLAST of Carg11076 vs. NCBI nr
Match: XP_004145025.1 (PREDICTED: putative invertase inhibitor [Cucumis sativus] >KGN46294.1 hypothetical protein Csa_6G080370 [Cucumis sativus]) HSP 1 Score: 233.4 bits (594), Expect = 6.2e-58 Identity = 135/192 (70.31%), Postives = 155/192 (80.73%), Query Frame = 0
BLAST of Carg11076 vs. NCBI nr
Match: XP_022958986.1 (putative invertase inhibitor [Cucurbita moschata]) HSP 1 Score: 232.6 bits (592), Expect = 1.1e-57 Identity = 130/189 (68.78%), Postives = 152/189 (80.42%), Query Frame = 0
BLAST of Carg11076 vs. TAIR10
Match: AT5G46940.1 (Plant invertase/pectin methylesterase inhibitor superfamily protein) HSP 1 Score: 94.7 bits (234), Expect = 6.2e-20 Identity = 57/177 (32.20%), Postives = 96/177 (54.24%), Query Frame = 0
BLAST of Carg11076 vs. TAIR10
Match: AT5G38610.1 (Plant invertase/pectin methylesterase inhibitor superfamily protein) HSP 1 Score: 82.0 bits (201), Expect = 4.2e-16 Identity = 62/198 (31.31%), Postives = 96/198 (48.48%), Query Frame = 0
BLAST of Carg11076 vs. TAIR10
Match: AT5G46970.1 (Plant invertase/pectin methylesterase inhibitor superfamily protein) HSP 1 Score: 79.3 bits (194), Expect = 2.7e-15 Identity = 50/149 (33.56%), Postives = 82/149 (55.03%), Query Frame = 0
BLAST of Carg11076 vs. TAIR10
Match: AT5G46930.1 (Plant invertase/pectin methylesterase inhibitor superfamily protein) HSP 1 Score: 65.5 bits (158), Expect = 4.0e-11 Identity = 53/185 (28.65%), Postives = 91/185 (49.19%), Query Frame = 0
BLAST of Carg11076 vs. TAIR10
Match: AT3G36659.1 (Plant invertase/pectin methylesterase inhibitor superfamily protein) HSP 1 Score: 54.7 bits (130), Expect = 7.1e-08 Identity = 26/56 (46.43%), Postives = 32/56 (57.14%), Query Frame = 0
BLAST of Carg11076 vs. Swiss-Prot
Match: sp|Q8GT41|PLA1_PLAAC (Putative invertase inhibitor OS=Platanus acerifolia OX=140101 PE=1 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 4.9e-22 Identity = 60/173 (34.68%), Postives = 111/173 (64.16%), Query Frame = 0
BLAST of Carg11076 vs. TrEMBL
Match: tr|A0A0A0KBR8|A0A0A0KBR8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G080370 PE=4 SV=1) HSP 1 Score: 233.4 bits (594), Expect = 4.1e-58 Identity = 135/192 (70.31%), Postives = 155/192 (80.73%), Query Frame = 0
BLAST of Carg11076 vs. TrEMBL
Match: tr|A0A1S3CBM6|A0A1S3CBM6_CUCME (putative invertase inhibitor OS=Cucumis melo OX=3656 GN=LOC103498982 PE=4 SV=1) HSP 1 Score: 215.7 bits (548), Expect = 8.8e-53 Identity = 127/194 (65.46%), Postives = 148/194 (76.29%), Query Frame = 0
BLAST of Carg11076 vs. TrEMBL
Match: tr|E5GC99|E5GC99_CUCME (Invertase inhibitor OS=Cucumis melo subsp. melo OX=412675 PE=4 SV=1) HSP 1 Score: 213.0 bits (541), Expect = 5.7e-52 Identity = 117/176 (66.48%), Postives = 138/176 (78.41%), Query Frame = 0
BLAST of Carg11076 vs. TrEMBL
Match: tr|A0A1S3CBQ9|A0A1S3CBQ9_CUCME (putative invertase inhibitor OS=Cucumis melo OX=3656 GN=LOC103498981 PE=4 SV=1) HSP 1 Score: 189.1 bits (479), Expect = 8.8e-45 Identity = 105/181 (58.01%), Postives = 130/181 (71.82%), Query Frame = 0
BLAST of Carg11076 vs. TrEMBL
Match: tr|A0A0A0K951|A0A0A0K951_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G080380 PE=4 SV=1) HSP 1 Score: 185.3 bits (469), Expect = 1.3e-43 Identity = 104/181 (57.46%), Postives = 129/181 (71.27%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |