Carg09371 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGCTCACACCTCAGCAGTTGATCGCCTACAATGGCACCGACTCATCGAAGCCGATCTATGTGGCTTTGAAGGGCCGCATCTTCGACGTCACAACAGGCGTTTCTTTCTACGGCCCCGGTGGCGCCTACGCCATGTTCGCTGGCAAGGACGCGAGCAGAGCTCTGGCCAAGATGACCAAGAATGAGGAGGACATCAATTCTTCGCTCGAAGGCTTATCTGAGAAAGAGATCGGTGTTCTCAACGACTGGGAGAAGAAATTTGAAGCTAAGTACCCTATTGTTGGTCGCGTTGTTTCTTAA ATGGAGCTCACACCTCAGCAGTTGATCGCCTACAATGGCACCGACTCATCGAAGCCGATCTATGTGGCTTTGAAGGGCCGCATCTTCGACGTCACAACAGGCGTTTCTTTCTACGGCCCCGGTGGCGCCTACGCCATGTTCGCTGGCAAGGACGCGAGCAGAGCTCTGGCCAAGATGACCAAGAATGAGGAGGACATCAATTCTTCGCTCGAAGGCTTATCTGAGAAAGAGATCGGTGTTCTCAACGACTGGGAGAAGAAATTTGAAGCTAAGTACCCTATTGTTGGTCGCGTTGTTTCTTAA ATGGAGCTCACACCTCAGCAGTTGATCGCCTACAATGGCACCGACTCATCGAAGCCGATCTATGTGGCTTTGAAGGGCCGCATCTTCGACGTCACAACAGGCGTTTCTTTCTACGGCCCCGGTGGCGCCTACGCCATGTTCGCTGGCAAGGACGCGAGCAGAGCTCTGGCCAAGATGACCAAGAATGAGGAGGACATCAATTCTTCGCTCGAAGGCTTATCTGAGAAAGAGATCGGTGTTCTCAACGACTGGGAGAAGAAATTTGAAGCTAAGTACCCTATTGTTGGTCGCGTTGTTTCTTAA MELTPQQLIAYNGTDSSKPIYVALKGRIFDVTTGVSFYGPGGAYAMFAGKDASRALAKMTKNEEDINSSLEGLSEKEIGVLNDWEKKFEAKYPIVGRVVS
BLAST of Carg09371 vs. NCBI nr
Match: XP_022962142.1 (probable steroid-binding protein 3 [Cucurbita moschata]) HSP 1 Score: 201.4 bits (511), Expect = 1.4e-48 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of Carg09371 vs. NCBI nr
Match: XP_022997574.1 (probable steroid-binding protein 3 [Cucurbita maxima]) HSP 1 Score: 199.5 bits (506), Expect = 5.3e-48 Identity = 99/100 (99.00%), Postives = 99/100 (99.00%), Query Frame = 0
BLAST of Carg09371 vs. NCBI nr
Match: XP_023547192.1 (probable steroid-binding protein 3 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 199.5 bits (506), Expect = 5.3e-48 Identity = 99/100 (99.00%), Postives = 99/100 (99.00%), Query Frame = 0
BLAST of Carg09371 vs. NCBI nr
Match: XP_022131551.1 (probable steroid-binding protein 3 [Momordica charantia]) HSP 1 Score: 189.5 bits (480), Expect = 5.5e-45 Identity = 93/100 (93.00%), Postives = 97/100 (97.00%), Query Frame = 0
BLAST of Carg09371 vs. NCBI nr
Match: XP_008445274.1 (PREDICTED: probable steroid-binding protein 3 [Cucumis melo]) HSP 1 Score: 182.2 bits (461), Expect = 8.8e-43 Identity = 88/100 (88.00%), Postives = 95/100 (95.00%), Query Frame = 0
BLAST of Carg09371 vs. TAIR10
Match: AT2G24940.1 (membrane-associated progesterone binding protein 2) HSP 1 Score: 164.9 bits (416), Expect = 2.6e-41 Identity = 78/100 (78.00%), Postives = 87/100 (87.00%), Query Frame = 0
BLAST of Carg09371 vs. TAIR10
Match: AT3G48890.1 (membrane-associated progesterone binding protein 3) HSP 1 Score: 109.8 bits (273), Expect = 1.0e-24 Identity = 50/97 (51.55%), Postives = 70/97 (72.16%), Query Frame = 0
BLAST of Carg09371 vs. TAIR10
Match: AT5G52240.1 (membrane steroid binding protein 1) HSP 1 Score: 106.7 bits (265), Expect = 8.5e-24 Identity = 51/97 (52.58%), Postives = 68/97 (70.10%), Query Frame = 0
BLAST of Carg09371 vs. TAIR10
Match: AT4G14965.1 (membrane-associated progesterone binding protein 4) HSP 1 Score: 80.9 bits (198), Expect = 5.0e-16 Identity = 39/94 (41.49%), Postives = 54/94 (57.45%), Query Frame = 0
BLAST of Carg09371 vs. Swiss-Prot
Match: sp|Q9SK39|SBP3_ARATH (Probable steroid-binding protein 3 OS=Arabidopsis thaliana OX=3702 GN=MP3 PE=1 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 4.7e-40 Identity = 78/100 (78.00%), Postives = 87/100 (87.00%), Query Frame = 0
BLAST of Carg09371 vs. Swiss-Prot
Match: sp|Q9FVZ9|MSBP2_ORYSJ (Membrane steroid-binding protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=MSBP2 PE=2 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 8.1e-24 Identity = 50/97 (51.55%), Postives = 70/97 (72.16%), Query Frame = 0
BLAST of Carg09371 vs. Swiss-Prot
Match: sp|Q9M2Z4|MSBP2_ARATH (Membrane steroid-binding protein 2 OS=Arabidopsis thaliana OX=3702 GN=MSBP2 PE=1 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 1.8e-23 Identity = 50/97 (51.55%), Postives = 70/97 (72.16%), Query Frame = 0
BLAST of Carg09371 vs. Swiss-Prot
Match: sp|Q9XFM6|MSBP1_ARATH (Membrane steroid-binding protein 1 OS=Arabidopsis thaliana OX=3702 GN=MSBP1 PE=1 SV=2) HSP 1 Score: 106.7 bits (265), Expect = 1.5e-22 Identity = 51/97 (52.58%), Postives = 68/97 (70.10%), Query Frame = 0
BLAST of Carg09371 vs. Swiss-Prot
Match: sp|Q9FVZ7|MSBP1_ORYSJ (Membrane steroid-binding protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=MSBP1 PE=1 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.5e-22 Identity = 50/97 (51.55%), Postives = 67/97 (69.07%), Query Frame = 0
BLAST of Carg09371 vs. TrEMBL
Match: tr|A0A1S3BD16|A0A1S3BD16_CUCME (probable steroid-binding protein 3 OS=Cucumis melo OX=3656 GN=LOC103488356 PE=3 SV=1) HSP 1 Score: 182.2 bits (461), Expect = 5.8e-43 Identity = 88/100 (88.00%), Postives = 95/100 (95.00%), Query Frame = 0
BLAST of Carg09371 vs. TrEMBL
Match: tr|M5XM79|M5XM79_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_1G396100 PE=3 SV=1) HSP 1 Score: 180.3 bits (456), Expect = 2.2e-42 Identity = 88/100 (88.00%), Postives = 92/100 (92.00%), Query Frame = 0
BLAST of Carg09371 vs. TrEMBL
Match: tr|A0A1J6I4A9|A0A1J6I4A9_NICAT (Putative steroid-binding protein 3 OS=Nicotiana attenuata OX=49451 GN=MP3 PE=3 SV=1) HSP 1 Score: 175.6 bits (444), Expect = 5.4e-41 Identity = 85/100 (85.00%), Postives = 92/100 (92.00%), Query Frame = 0
BLAST of Carg09371 vs. TrEMBL
Match: tr|A0A2N9F3N2|A0A2N9F3N2_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS9286 PE=3 SV=1) HSP 1 Score: 174.5 bits (441), Expect = 1.2e-40 Identity = 84/100 (84.00%), Postives = 91/100 (91.00%), Query Frame = 0
BLAST of Carg09371 vs. TrEMBL
Match: tr|A0A1S3U298|A0A1S3U298_VIGRR (probable steroid-binding protein 3 OS=Vigna radiata var. radiata OX=3916 GN=LOC106761144 PE=3 SV=1) HSP 1 Score: 174.5 bits (441), Expect = 1.2e-40 Identity = 81/100 (81.00%), Postives = 93/100 (93.00%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|