Carg05036 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAAAGGCGGCTGTTATTGCTATAAGGTGTGTAGAGAGAGATGCTTCATTAAGGCCTAATATTGGACAAGTCTTGGATGACCTTAAACAAGCTTATGATGCTCAAATTGCTTATCTTTCTACTTTTGGCCTTTAA ATGAAAAAGGCGGCTGTTATTGCTATAAGGTGTGTAGAGAGAGATGCTTCATTAAGGCCTAATATTGGACAAGTCTTGGATGACCTTAAACAAGCTTATGATGCTCAAATTGCTTATCTTTCTACTTTTGGCCTTTAA ATGAAAAAGGCGGCTGTTATTGCTATAAGGTGTGTAGAGAGAGATGCTTCATTAAGGCCTAATATTGGACAAGTCTTGGATGACCTTAAACAAGCTTATGATGCTCAAATTGCTTATCTTTCTACTTTTGGCCTTTAA MKKAAVIAIRCVERDASLRPNIGQVLDDLKQAYDAQIAYLSTFGL
BLAST of Carg05036 vs. NCBI nr
Match: XP_023514133.1 (probable LRR receptor-like serine/threonine-protein kinase At5g48740 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 90.5 bits (223), Expect = 1.6e-15 Identity = 45/45 (100.00%), Postives = 45/45 (100.00%), Query Frame = 0
BLAST of Carg05036 vs. NCBI nr
Match: XP_022960256.1 (probable LRR receptor-like serine/threonine-protein kinase At5g48740 [Cucurbita moschata]) HSP 1 Score: 88.2 bits (217), Expect = 7.8e-15 Identity = 44/45 (97.78%), Postives = 44/45 (97.78%), Query Frame = 0
BLAST of Carg05036 vs. NCBI nr
Match: XP_023004808.1 (probable LRR receptor-like serine/threonine-protein kinase At5g48740 [Cucurbita maxima]) HSP 1 Score: 87.0 bits (214), Expect = 1.7e-14 Identity = 43/45 (95.56%), Postives = 44/45 (97.78%), Query Frame = 0
BLAST of Carg05036 vs. NCBI nr
Match: XP_004139634.1 (PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At5g48740 [Cucumis sativus] >KGN44594.1 hypothetical protein Csa_7G339660 [Cucumis sativus]) HSP 1 Score: 78.6 bits (192), Expect = 6.2e-12 Identity = 38/43 (88.37%), Postives = 41/43 (95.35%), Query Frame = 0
BLAST of Carg05036 vs. NCBI nr
Match: XP_016902217.1 (PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At5g48740 isoform X1 [Cucumis melo]) HSP 1 Score: 76.6 bits (187), Expect = 2.3e-11 Identity = 37/43 (86.05%), Postives = 40/43 (93.02%), Query Frame = 0
BLAST of Carg05036 vs. TAIR10
Match: AT5G48740.1 (Leucine-rich repeat protein kinase family protein) HSP 1 Score: 54.7 bits (130), Expect = 1.7e-08 Identity = 27/41 (65.85%), Postives = 33/41 (80.49%), Query Frame = 0
BLAST of Carg05036 vs. Swiss-Prot
Match: sp|C0LGV0|Y5487_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g48740 OS=Arabidopsis thaliana OX=3702 GN=At5g48740 PE=2 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 3.1e-07 Identity = 27/41 (65.85%), Postives = 33/41 (80.49%), Query Frame = 0
BLAST of Carg05036 vs. TrEMBL
Match: tr|A0A0A0K6R0|A0A0A0K6R0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G339660 PE=4 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 4.1e-12 Identity = 38/43 (88.37%), Postives = 41/43 (95.35%), Query Frame = 0
BLAST of Carg05036 vs. TrEMBL
Match: tr|A0A1S4E1W5|A0A1S4E1W5_CUCME (probable LRR receptor-like serine/threonine-protein kinase At5g48740 isoform X1 OS=Cucumis melo OX=3656 GN=LOC103497546 PE=4 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.5e-11 Identity = 37/43 (86.05%), Postives = 40/43 (93.02%), Query Frame = 0
BLAST of Carg05036 vs. TrEMBL
Match: tr|A0A1S3C6S9|A0A1S3C6S9_CUCME (probable LRR receptor-like serine/threonine-protein kinase At5g48740 isoform X3 OS=Cucumis melo OX=3656 GN=LOC103497546 PE=4 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.5e-11 Identity = 37/43 (86.05%), Postives = 40/43 (93.02%), Query Frame = 0
BLAST of Carg05036 vs. TrEMBL
Match: tr|A0A1S3C6C6|A0A1S3C6C6_CUCME (probable LRR receptor-like serine/threonine-protein kinase At5g48740 isoform X2 OS=Cucumis melo OX=3656 GN=LOC103497546 PE=4 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.5e-11 Identity = 37/43 (86.05%), Postives = 40/43 (93.02%), Query Frame = 0
BLAST of Carg05036 vs. TrEMBL
Match: tr|A0A1U8P4P8|A0A1U8P4P8_GOSHI (probable LRR receptor-like serine/threonine-protein kinase At5g48740 isoform X1 OS=Gossypium hirsutum OX=3635 GN=LOC107954911 PE=4 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 3.9e-07 Identity = 27/44 (61.36%), Postives = 36/44 (81.82%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|