Carg03220 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: exonfive_prime_UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.AAAACCTGTGTTCTTTTCAGGTTTCCAGTTTTTTAATTTTCCACAATTGATGAGTTTTTGCTGTTAGATTGAAGCTTTCACTTCAACATGAACCCTTACTCTGAAGATAGTGTAAGCTGCTAAAGTTCTACACCTTGGTGTTTTCATCAACCAATAATATGAAATGGGGATTTAAAGATGTATCCTTTCTACAGGATCGGACCACCGTAGTTGGTTTCGAAGTCCCGAAGTCCCCCGATTCAACCTATAACAATGAATACCGTGGGACCGAAGACGAGGCACGTGATCCACCATTTGTCCCACCTCATTTGCAGCACACCTTACTCAGCCACCCAGCAAGTAGAGATACCAGTGGAACTCTTCCATTGCCTCAGAATGTAATTCTCAACCATCTTTTTATCGAAAACCGAGACACCCCACGTTCCGTTGTAGCTCTTGGATTCACACACCGTTTTCATTCAAAATACGTCACGGTTGTGCTTTACAAACCAGTTCACAGAACAGGAACTAGCCGAGCT AAAACCTGTGTTCTTTTCAGGTTTCCAGTTTTTTAATTTTCCACAATTGATGAGTTTTTGCTGTTAGATTGAAGCTTTCACTTCAACATGAACCCTTACTCTGAAGATAGTGATCGGACCACCGTAGTTGGTTTCGAAGTCCCGAAGTCCCCCGATTCAACCTATAACAATGAATACCGTGGGACCGAAGACGAGGCACGTGATCCACCATTTGTCCCACCTCATTTGCAGCACACCTTACTCAGCCACCCAGCAAGTAGAGATACCAGTGGAACTCTTCCATTGCCTCAGAATGTAATTCTCAACCATCTTTTTATCGAAAACCGAGACACCCCACGTTCCGTTGTAGCTCTTGGATTCACACACCGTTTTCATTCAAAATACGTCACGGTTGTGCTTTACAAACCAGTTCACAGAACAGGAACTAGCCGAGCT ATGAACCCTTACTCTGAAGATAGTGATCGGACCACCGTAGTTGGTTTCGAAGTCCCGAAGTCCCCCGATTCAACCTATAACAATGAATACCGTGGGACCGAAGACGAGGCACGTGATCCACCATTTGTCCCACCTCATTTGCAGCACACCTTACTCAGCCACCCAGCAAGTAGAGATACCAGTGGAACTCTTCCATTGCCTCAGAATGTAATTCTCAACCATCTTTTTATCGAAAACCGAGACACCCCACGTTCCGTTGTAGCTCTTGGATTCACACACCGTTTTCATTCAAAATACGTCACGGTTGTGCTTTACAAACCAGTTCACAGAACAGGAACTAGCCGAGCT MNPYSEDSDRTTVVGFEVPKSPDSTYNNEYRGTEDEARDPPFVPPHLQHTLLSHPASRDTSGTLPLPQNVILNHLFIENRDTPRSVVALGFTHRFHSKYVTVVLYKPVHRTGTSRA
BLAST of Carg03220 vs. NCBI nr
Match: XP_022944084.1 (SNF1-related protein kinase regulatory subunit beta-3-like [Cucurbita moschata]) HSP 1 Score: 239.6 bits (610), Expect = 5.4e-60 Identity = 114/116 (98.28%), Postives = 114/116 (98.28%), Query Frame = 0
BLAST of Carg03220 vs. NCBI nr
Match: XP_023512097.1 (SNF1-related protein kinase regulatory subunit beta-3 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 239.2 bits (609), Expect = 7.0e-60 Identity = 114/116 (98.28%), Postives = 115/116 (99.14%), Query Frame = 0
BLAST of Carg03220 vs. NCBI nr
Match: XP_022986207.1 (SNF1-related protein kinase regulatory subunit beta-3-like [Cucurbita maxima]) HSP 1 Score: 236.5 bits (602), Expect = 4.6e-59 Identity = 113/116 (97.41%), Postives = 114/116 (98.28%), Query Frame = 0
BLAST of Carg03220 vs. NCBI nr
Match: XP_022140750.1 (SNF1-related protein kinase regulatory subunit beta-3 [Momordica charantia] >XP_022140751.1 SNF1-related protein kinase regulatory subunit beta-3 [Momordica charantia]) HSP 1 Score: 212.2 bits (539), Expect = 9.2e-52 Identity = 100/115 (86.96%), Postives = 106/115 (92.17%), Query Frame = 0
BLAST of Carg03220 vs. NCBI nr
Match: XP_022958406.1 (SNF1-related protein kinase regulatory subunit beta-3-like [Cucurbita moschata] >XP_022958407.1 SNF1-related protein kinase regulatory subunit beta-3-like [Cucurbita moschata] >XP_022958408.1 SNF1-related protein kinase regulatory subunit beta-3-like [Cucurbita moschata]) HSP 1 Score: 211.5 bits (537), Expect = 1.6e-51 Identity = 99/113 (87.61%), Postives = 106/113 (93.81%), Query Frame = 0
BLAST of Carg03220 vs. TAIR10
Match: AT2G28060.1 (5'-AMP-activated protein kinase beta-2 subunit protein) HSP 1 Score: 147.9 bits (372), Expect = 3.9e-36 Identity = 71/109 (65.14%), Postives = 86/109 (78.90%), Query Frame = 0
BLAST of Carg03220 vs. TAIR10
Match: AT4G16360.3 (5'-AMP-activated protein kinase beta-2 subunit protein) HSP 1 Score: 110.9 bits (276), Expect = 5.2e-25 Identity = 56/103 (54.37%), Postives = 75/103 (72.82%), Query Frame = 0
BLAST of Carg03220 vs. TAIR10
Match: AT5G21170.2 (5'-AMP-activated protein kinase beta-2 subunit protein) HSP 1 Score: 99.0 bits (245), Expect = 2.1e-21 Identity = 50/99 (50.51%), Postives = 65/99 (65.66%), Query Frame = 0
BLAST of Carg03220 vs. Swiss-Prot
Match: sp|Q9ZUU8|KINB3_ARATH (SNF1-related protein kinase regulatory subunit beta-3 OS=Arabidopsis thaliana OX=3702 GN=KINB3 PE=1 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 7.0e-35 Identity = 71/109 (65.14%), Postives = 86/109 (78.90%), Query Frame = 0
BLAST of Carg03220 vs. Swiss-Prot
Match: sp|Q9SCY5|KINB2_ARATH (SNF1-related protein kinase regulatory subunit beta-2 OS=Arabidopsis thaliana OX=3702 GN=KINB2 PE=1 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 9.4e-24 Identity = 56/103 (54.37%), Postives = 75/103 (72.82%), Query Frame = 0
BLAST of Carg03220 vs. Swiss-Prot
Match: sp|Q84VQ1|KINB1_ARATH (SNF1-related protein kinase regulatory subunit beta-1 OS=Arabidopsis thaliana OX=3702 GN=KINB1 PE=1 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 3.7e-20 Identity = 50/99 (50.51%), Postives = 65/99 (65.66%), Query Frame = 0
BLAST of Carg03220 vs. Swiss-Prot
Match: sp|Q9QZH4|AAKB2_RAT (5'-AMP-activated protein kinase subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Prkab2 PE=1 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 5.0e-09 Identity = 35/95 (36.84%), Postives = 51/95 (53.68%), Query Frame = 0
BLAST of Carg03220 vs. Swiss-Prot
Match: sp|O43741|AAKB2_HUMAN (5'-AMP-activated protein kinase subunit beta-2 OS=Homo sapiens OX=9606 GN=PRKAB2 PE=1 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.1e-08 Identity = 35/96 (36.46%), Postives = 53/96 (55.21%), Query Frame = 0
BLAST of Carg03220 vs. TrEMBL
Match: tr|A0A1S3CP39|A0A1S3CP39_CUCME (SNF1-related protein kinase regulatory subunit beta-3 OS=Cucumis melo OX=3656 GN=LOC103502997 PE=4 SV=1) HSP 1 Score: 210.7 bits (535), Expect = 1.8e-51 Identity = 102/115 (88.70%), Postives = 106/115 (92.17%), Query Frame = 0
BLAST of Carg03220 vs. TrEMBL
Match: tr|A0A0A0KBG3|A0A0A0KBG3_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G147560 PE=4 SV=1) HSP 1 Score: 210.7 bits (535), Expect = 1.8e-51 Identity = 102/115 (88.70%), Postives = 106/115 (92.17%), Query Frame = 0
BLAST of Carg03220 vs. TrEMBL
Match: tr|D7SNE5|D7SNE5_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VIT_06s0061g00300 PE=4 SV=1) HSP 1 Score: 190.7 bits (483), Expect = 1.9e-45 Identity = 90/113 (79.65%), Postives = 100/113 (88.50%), Query Frame = 0
BLAST of Carg03220 vs. TrEMBL
Match: tr|V4SB90|V4SB90_9ROSI (Uncharacterized protein OS=Citrus clementina OX=85681 GN=CICLE_v10029607mg PE=4 SV=1) HSP 1 Score: 189.9 bits (481), Expect = 3.2e-45 Identity = 93/117 (79.49%), Postives = 100/117 (85.47%), Query Frame = 0
BLAST of Carg03220 vs. TrEMBL
Match: tr|K7LQC9|K7LQC9_SOYBN (Uncharacterized protein OS=Glycine max OX=3847 GN=100785077 PE=4 SV=1) HSP 1 Score: 189.5 bits (480), Expect = 4.2e-45 Identity = 88/113 (77.88%), Postives = 100/113 (88.50%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|