Carg03218 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGACTAAGCTTGTGACCGTAGCCATGAAGAAGAATGGCATTGTCAAGCTCAAGTCCGCCGTTGGGAAGCTGCAGAGAAGCCTCTCCTTAGGTCGGAGGTCTGATTCTGGTCAAGATGACTTCGATTACGACTCGACTCCGGTACCGGAGGATGTCAAAGAAGGACATTTTGCAGTTGTGGCAGTTGATGCTGAGGAGCCGAAACGGTTTGCTGTTCCGTTGAGTTGCTTGACGAATCCGACGTTTTTGAGACTGTTGGAGGCGGCGGCTGAGGAGTATGGATTTGATCATGAAGGTGCAGTGACCGTGCCATGTCGGCCGAGCGAGCTCGAGCAGATCTTGGCCGAGGAATAG ATGACTAAGCTTGTGACCGTAGCCATGAAGAAGAATGGCATTGTCAAGCTCAAGTCCGCCGTTGGGAAGCTGCAGAGAAGCCTCTCCTTAGGTCGGAGGTCTGATTCTGGTCAAGATGACTTCGATTACGACTCGACTCCGGTACCGGAGGATGTCAAAGAAGGACATTTTGCAGTTGTGGCAGTTGATGCTGAGGAGCCGAAACGGTTTGCTGTTCCGTTGAGTTGCTTGACGAATCCGACGTTTTTGAGACTGTTGGAGGCGGCGGCTGAGGAGTATGGATTTGATCATGAAGGTGCAGTGACCGTGCCATGTCGGCCGAGCGAGCTCGAGCAGATCTTGGCCGAGGAATAG ATGACTAAGCTTGTGACCGTAGCCATGAAGAAGAATGGCATTGTCAAGCTCAAGTCCGCCGTTGGGAAGCTGCAGAGAAGCCTCTCCTTAGGTCGGAGGTCTGATTCTGGTCAAGATGACTTCGATTACGACTCGACTCCGGTACCGGAGGATGTCAAAGAAGGACATTTTGCAGTTGTGGCAGTTGATGCTGAGGAGCCGAAACGGTTTGCTGTTCCGTTGAGTTGCTTGACGAATCCGACGTTTTTGAGACTGTTGGAGGCGGCGGCTGAGGAGTATGGATTTGATCATGAAGGTGCAGTGACCGTGCCATGTCGGCCGAGCGAGCTCGAGCAGATCTTGGCCGAGGAATAG MTKLVTVAMKKNGIVKLKSAVGKLQRSLSLGRRSDSGQDDFDYDSTPVPEDVKEGHFAVVAVDAEEPKRFAVPLSCLTNPTFLRLLEAAAEEYGFDHEGAVTVPCRPSELEQILAEE
BLAST of Carg03218 vs. NCBI nr
Match: XP_023512258.1 (auxin-responsive protein SAUR50 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 231.1 bits (588), Expect = 1.9e-57 Identity = 117/117 (100.00%), Postives = 117/117 (100.00%), Query Frame = 0
BLAST of Carg03218 vs. NCBI nr
Match: XP_022986206.1 (auxin-responsive protein SAUR50 [Cucurbita maxima]) HSP 1 Score: 225.7 bits (574), Expect = 8.1e-56 Identity = 114/117 (97.44%), Postives = 116/117 (99.15%), Query Frame = 0
BLAST of Carg03218 vs. NCBI nr
Match: XP_022944522.1 (auxin-responsive protein SAUR50 [Cucurbita moschata]) HSP 1 Score: 218.4 bits (555), Expect = 1.3e-53 Identity = 109/109 (100.00%), Postives = 109/109 (100.00%), Query Frame = 0
BLAST of Carg03218 vs. NCBI nr
Match: XP_004145816.1 (PREDICTED: uncharacterized protein LOC101212725 [Cucumis sativus] >KGN46866.1 hypothetical protein Csa_6G147590 [Cucumis sativus]) HSP 1 Score: 204.9 bits (520), Expect = 1.5e-49 Identity = 106/123 (86.18%), Postives = 111/123 (90.24%), Query Frame = 0
BLAST of Carg03218 vs. NCBI nr
Match: XP_008465358.1 (PREDICTED: auxin-responsive protein SAUR32-like [Cucumis melo]) HSP 1 Score: 199.1 bits (505), Expect = 8.1e-48 Identity = 104/123 (84.55%), Postives = 111/123 (90.24%), Query Frame = 0
BLAST of Carg03218 vs. TAIR10
Match: AT2G28085.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 98.6 bits (244), Expect = 2.7e-21 Identity = 55/110 (50.00%), Postives = 69/110 (62.73%), Query Frame = 0
BLAST of Carg03218 vs. TAIR10
Match: AT3G09870.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 82.0 bits (201), Expect = 2.6e-16 Identity = 37/67 (55.22%), Postives = 47/67 (70.15%), Query Frame = 0
BLAST of Carg03218 vs. TAIR10
Match: AT4G34760.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 69.7 bits (169), Expect = 1.3e-12 Identity = 36/82 (43.90%), Postives = 50/82 (60.98%), Query Frame = 0
BLAST of Carg03218 vs. TAIR10
Match: AT1G19830.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 65.9 bits (159), Expect = 1.9e-11 Identity = 34/92 (36.96%), Postives = 52/92 (56.52%), Query Frame = 0
BLAST of Carg03218 vs. TAIR10
Match: AT2G16580.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 63.5 bits (153), Expect = 9.7e-11 Identity = 34/82 (41.46%), Postives = 47/82 (57.32%), Query Frame = 0
BLAST of Carg03218 vs. Swiss-Prot
Match: sp|O65695|SAU50_ARATH (Auxin-responsive protein SAUR50 OS=Arabidopsis thaliana OX=3702 GN=SAUR50 PE=1 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 2.4e-11 Identity = 36/82 (43.90%), Postives = 50/82 (60.98%), Query Frame = 0
BLAST of Carg03218 vs. Swiss-Prot
Match: sp|P0DKL1|SAU50_HELAN (Auxin-responsive protein SAUR50 OS=Helianthus annuus OX=4232 PE=3 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 1.3e-09 Identity = 27/63 (42.86%), Postives = 41/63 (65.08%), Query Frame = 0
BLAST of Carg03218 vs. Swiss-Prot
Match: sp|Q9ZUZ3|SAU32_ARATH (Auxin-responsive protein SAUR32 OS=Arabidopsis thaliana OX=3702 GN=SAUR32 PE=2 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 2.5e-08 Identity = 27/67 (40.30%), Postives = 41/67 (61.19%), Query Frame = 0
BLAST of Carg03218 vs. Swiss-Prot
Match: sp|P33079|A10A5_SOYBN (Auxin-induced protein 10A5 OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 6.2e-07 Identity = 27/66 (40.91%), Postives = 40/66 (60.61%), Query Frame = 0
BLAST of Carg03218 vs. Swiss-Prot
Match: sp|Q9SL45|SAU10_ARATH (Protein SMALL AUXIN UP-REGULATED RNA 10 OS=Arabidopsis thaliana OX=3702 GN=SAUR10 PE=2 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 1.4e-06 Identity = 25/58 (43.10%), Postives = 35/58 (60.34%), Query Frame = 0
BLAST of Carg03218 vs. TrEMBL
Match: tr|A0A0A0KGI2|A0A0A0KGI2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G147590 PE=4 SV=1) HSP 1 Score: 204.9 bits (520), Expect = 9.8e-50 Identity = 106/123 (86.18%), Postives = 111/123 (90.24%), Query Frame = 0
BLAST of Carg03218 vs. TrEMBL
Match: tr|A0A1S3CNL2|A0A1S3CNL2_CUCME (auxin-responsive protein SAUR32-like OS=Cucumis melo OX=3656 GN=LOC103502995 PE=4 SV=1) HSP 1 Score: 199.1 bits (505), Expect = 5.4e-48 Identity = 104/123 (84.55%), Postives = 111/123 (90.24%), Query Frame = 0
BLAST of Carg03218 vs. TrEMBL
Match: tr|A0A2N9EYY9|A0A2N9EYY9_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS7656 PE=4 SV=1) HSP 1 Score: 158.7 bits (400), Expect = 8.1e-36 Identity = 81/120 (67.50%), Postives = 97/120 (80.83%), Query Frame = 0
BLAST of Carg03218 vs. TrEMBL
Match: tr|F6GWA1|F6GWA1_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VIT_06s0061g00390 PE=4 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 3.1e-35 Identity = 79/112 (70.54%), Postives = 93/112 (83.04%), Query Frame = 0
BLAST of Carg03218 vs. TrEMBL
Match: tr|D7SND5|D7SND5_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VIT_06s0061g00400 PE=4 SV=1) HSP 1 Score: 156.0 bits (393), Expect = 5.2e-35 Identity = 84/120 (70.00%), Postives = 96/120 (80.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|