Carg00584 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGCTCCCTCGACAGGTCTCTCGTCTCTCTGTATTTCATTTATACGCCCTTTCCTCTATCTCTTCTCCTCGCAGCCTTTCATTTAGATTATCCTTCTTCCGTTTGAATTTCTGCTCTGTTTTTTTGTTGGCAGTTCCAGTGCCGGAGTCGTCACCGTCGATGTCCTGACGGCCAAGAAACTGCTCGACTCCGGCTACGCTTTTCTCGACGTTAGGTTGGAGCTTAATTTTGTTTAATTTCTCCGTCTCGTTGATTTTATAAAAAATTATTGGTGTGGTTTTTAAAATTTTTTGACAGGACCGTTGAGGAGTTTCAGGAAGGACACGTGGCAGCGGAGAAGATCGTCAATATTCCTTACTTCTTCTCTTCTCCAAATGGTATACATCGGAACTCTGTTTCTTCTTCCTTTCAATTTCTTTATTCCGGCGAGTTGCCTGAAAAACGCGGCGTTTGGATTTTCAGGCAGGGTTAAGAACGACCGGTTTCTGGAGGAGGTGTCGGCGGTCTTTAAGAAAGACGACTACTTCATCGTG ATGAGCTCCCTCGACAGTTCCAGTGCCGGAGTCGTCACCGTCGATGTCCTGACGGCCAAGAAACTGCTCGACTCCGGCTACGCTTTTCTCGACGTTAGGACCGTTGAGGAGTTTCAGGAAGGACACGTGGCAGCGGAGAAGATCGTCAATATTCCTTACTTCTTCTCTTCTCCAAATGGCAGGGTTAAGAACGACCGGTTTCTGGAGGAGGTGTCGGCGGTCTTTAAGAAAGACGACTACTTCATCGTG ATGAGCTCCCTCGACAGTTCCAGTGCCGGAGTCGTCACCGTCGATGTCCTGACGGCCAAGAAACTGCTCGACTCCGGCTACGCTTTTCTCGACGTTAGGACCGTTGAGGAGTTTCAGGAAGGACACGTGGCAGCGGAGAAGATCGTCAATATTCCTTACTTCTTCTCTTCTCCAAATGGCAGGGTTAAGAACGACCGGTTTCTGGAGGAGGTGTCGGCGGTCTTTAAGAAAGACGACTACTTCATCGTG MSSLDSSSAGVVTVDVLTAKKLLDSGYAFLDVRTVEEFQEGHVAAEKIVNIPYFFSSPNGRVKNDRFLEEVSAVFKKDDYFIV
BLAST of Carg00584 vs. NCBI nr
Match: XP_022949670.1 (thiosulfate sulfurtransferase 18-like [Cucurbita moschata]) HSP 1 Score: 162.9 bits (411), Expect = 4.6e-37 Identity = 83/83 (100.00%), Postives = 83/83 (100.00%), Query Frame = 0
BLAST of Carg00584 vs. NCBI nr
Match: XP_023545014.1 (thiosulfate sulfurtransferase 18-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 160.6 bits (405), Expect = 2.3e-36 Identity = 82/83 (98.80%), Postives = 82/83 (98.80%), Query Frame = 0
BLAST of Carg00584 vs. NCBI nr
Match: XP_022977640.1 (thiosulfate sulfurtransferase 18-like [Cucurbita maxima]) HSP 1 Score: 157.9 bits (398), Expect = 1.5e-35 Identity = 80/83 (96.39%), Postives = 82/83 (98.80%), Query Frame = 0
BLAST of Carg00584 vs. NCBI nr
Match: XP_022977637.1 (thiosulfate sulfurtransferase 18-like isoform X2 [Cucurbita maxima]) HSP 1 Score: 134.4 bits (337), Expect = 1.7e-28 Identity = 68/83 (81.93%), Postives = 73/83 (87.95%), Query Frame = 0
BLAST of Carg00584 vs. NCBI nr
Match: XP_023545011.1 (thiosulfate sulfurtransferase 18-like isoform X1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 133.3 bits (334), Expect = 3.9e-28 Identity = 67/83 (80.72%), Postives = 73/83 (87.95%), Query Frame = 0
BLAST of Carg00584 vs. TAIR10
Match: AT2G17850.1 (Rhodanese/Cell cycle control phosphatase superfamily protein) HSP 1 Score: 84.7 bits (208), Expect = 2.9e-17 Identity = 39/77 (50.65%), Postives = 56/77 (72.73%), Query Frame = 0
BLAST of Carg00584 vs. TAIR10
Match: AT5G66170.2 (sulfurtransferase 18) HSP 1 Score: 84.0 bits (206), Expect = 4.9e-17 Identity = 42/81 (51.85%), Postives = 55/81 (67.90%), Query Frame = 0
BLAST of Carg00584 vs. TAIR10
Match: AT2G21045.1 (Rhodanese/Cell cycle control phosphatase superfamily protein) HSP 1 Score: 74.7 bits (182), Expect = 3.0e-14 Identity = 39/73 (53.42%), Postives = 51/73 (69.86%), Query Frame = 0
BLAST of Carg00584 vs. TAIR10
Match: AT4G35770.1 (Rhodanese/Cell cycle control phosphatase superfamily protein) HSP 1 Score: 62.0 bits (149), Expect = 2.0e-10 Identity = 30/71 (42.25%), Postives = 45/71 (63.38%), Query Frame = 0
BLAST of Carg00584 vs. TAIR10
Match: AT5G66040.1 (sulfurtransferase protein 16) HSP 1 Score: 58.2 bits (139), Expect = 2.9e-09 Identity = 31/71 (43.66%), Postives = 42/71 (59.15%), Query Frame = 0
BLAST of Carg00584 vs. Swiss-Prot
Match: sp|F4IPI4|STR17_ARATH (Rhodanese-like domain-containing protein 17 OS=Arabidopsis thaliana OX=3702 GN=STR17 PE=2 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 5.2e-16 Identity = 39/77 (50.65%), Postives = 56/77 (72.73%), Query Frame = 0
BLAST of Carg00584 vs. Swiss-Prot
Match: sp|Q9FKW8|STR18_ARATH (Thiosulfate sulfurtransferase 18 OS=Arabidopsis thaliana OX=3702 GN=STR18 PE=1 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 8.8e-16 Identity = 42/81 (51.85%), Postives = 55/81 (67.90%), Query Frame = 0
BLAST of Carg00584 vs. Swiss-Prot
Match: sp|Q8RUD6|HARC1_ARATH (Protein HIGH ARSENIC CONTENT 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=HAC1 PE=1 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 5.4e-13 Identity = 39/73 (53.42%), Postives = 51/73 (69.86%), Query Frame = 0
BLAST of Carg00584 vs. Swiss-Prot
Match: sp|Q38853|STR15_ARATH (Rhodanese-like domain-containing protein 15, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=STR15 PE=2 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 3.6e-09 Identity = 30/71 (42.25%), Postives = 45/71 (63.38%), Query Frame = 0
BLAST of Carg00584 vs. Swiss-Prot
Match: sp|P27626|DIN1_RAPSA (Senescence-associated protein DIN1 OS=Raphanus sativus OX=3726 GN=DIN1 PE=2 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 8.0e-09 Identity = 30/71 (42.25%), Postives = 44/71 (61.97%), Query Frame = 0
BLAST of Carg00584 vs. TrEMBL
Match: tr|A0A1S3B1L3|A0A1S3B1L3_CUCME (thiosulfate sulfurtransferase 18 isoform X1 OS=Cucumis melo OX=3656 GN=LOC103485140 PE=4 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 9.1e-26 Identity = 62/83 (74.70%), Postives = 70/83 (84.34%), Query Frame = 0
BLAST of Carg00584 vs. TrEMBL
Match: tr|A0A1S3B236|A0A1S3B236_CUCME (uncharacterized protein LOC103485140 isoform X2 OS=Cucumis melo OX=3656 GN=LOC103485140 PE=4 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 9.1e-26 Identity = 62/83 (74.70%), Postives = 70/83 (84.34%), Query Frame = 0
BLAST of Carg00584 vs. TrEMBL
Match: tr|A0A0A0KJE7|A0A0A0KJE7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G507040 PE=4 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 7.7e-25 Identity = 63/84 (75.00%), Postives = 71/84 (84.52%), Query Frame = 0
BLAST of Carg00584 vs. TrEMBL
Match: tr|A0A2I4EL02|A0A2I4EL02_9ROSI (rhodanese-like domain-containing protein 17 OS=Juglans regia OX=51240 GN=LOC108990534 PE=4 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 6.8e-21 Identity = 54/83 (65.06%), Postives = 66/83 (79.52%), Query Frame = 0
BLAST of Carg00584 vs. TrEMBL
Match: tr|A0A2I4HLK8|A0A2I4HLK8_9ROSI (thiosulfate sulfurtransferase 18-like isoform X2 OS=Juglans regia OX=51240 GN=LOC109019245 PE=4 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 6.8e-21 Identity = 54/83 (65.06%), Postives = 66/83 (79.52%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |