BhiUN533G10 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAGTGAAAGGCGAAGCGGCGGTGAGGATGGGGATCGTGGAATCGGCTCACGACGGCGAGGACGGCGTCATGGAGGCTGCCGTACGACTCGGGGAGCAGTTGGGGGCGAGAAATTGGAACGGTGAACCCTACGCGGAAATTAGGAAAAGTCTTTACCCAGAGATCTCTCGGCTGCTTGGATTGCCGGAGAAGGCCATATCGATTTCCAAGCTATGA ATGAAAGTGAAAGGCGAAGCGGCGGTGAGGATGGGGATCGTGGAATCGGCTCACGACGGCGAGGACGGCGTCATGGAGGCTGCCGTACGACTCGGGGAGCAGTTGGGGGCGAGAAATTGGAACGGTGAACCCTACGCGGAAATTAGGAAAAGTCTTTACCCAGAGATCTCTCGGCTGCTTGGATTGCCGGAGAAGGCCATATCGATTTCCAAGCTATGA ATGAAAGTGAAAGGCGAAGCGGCGGTGAGGATGGGGATCGTGGAATCGGCTCACGACGGCGAGGACGGCGTCATGGAGGCTGCCGTACGACTCGGGGAGCAGTTGGGGGCGAGAAATTGGAACGGTGAACCCTACGCGGAAATTAGGAAAAGTCTTTACCCAGAGATCTCTCGGCTGCTTGGATTGCCGGAGAAGGCCATATCGATTTCCAAGCTATGA MKVKGEAAVRMGIVESAHDGEDGVMEAAVRLGEQLGARNWNGEPYAEIRKSLYPEISRLLGLPEKAISISKL
BLAST of BhiUN533G10 vs. TAIR10
Match: AT4G14430.1 (indole-3-butyric acid response 10) HSP 1 Score: 80.9 bits (198), Expect = 3.6e-16 Identity = 40/72 (55.56%), Postives = 55/72 (76.39%), Query Frame = 0
BLAST of BhiUN533G10 vs. TAIR10
Match: AT4G14440.1 (3-hydroxyacyl-CoA dehydratase 1) HSP 1 Score: 79.0 bits (193), Expect = 1.4e-15 Identity = 40/72 (55.56%), Postives = 51/72 (70.83%), Query Frame = 0
BLAST of BhiUN533G10 vs. TAIR10
Match: AT1G65520.1 (delta(3), delta(2)-enoyl CoA isomerase 1) HSP 1 Score: 46.6 bits (109), Expect = 7.5e-06 Identity = 22/55 (40.00%), Postives = 36/55 (65.45%), Query Frame = 0
BLAST of BhiUN533G10 vs. Swiss-Prot
Match: sp|O23299|ECI2_ARATH (Enoyl-CoA delta isomerase 2, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=ECI2 PE=1 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 6.5e-15 Identity = 40/72 (55.56%), Postives = 55/72 (76.39%), Query Frame = 0
BLAST of BhiUN533G10 vs. Swiss-Prot
Match: sp|O23300|ECI3_ARATH (Enoyl-CoA delta isomerase 3 OS=Arabidopsis thaliana OX=3702 GN=ECI3 PE=1 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 2.5e-14 Identity = 40/72 (55.56%), Postives = 51/72 (70.83%), Query Frame = 0
BLAST of BhiUN533G10 vs. Swiss-Prot
Match: sp|O04469|ECI1_ARATH (Enoyl-CoA delta isomerase 1, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=ECI1 PE=1 SV=1) HSP 1 Score: 46.6 bits (109), Expect = 1.4e-04 Identity = 22/55 (40.00%), Postives = 36/55 (65.45%), Query Frame = 0
BLAST of BhiUN533G10 vs. TrEMBL
Match: tr|A0A0A0L8C7|A0A0A0L8C7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G141780 PE=4 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 2.9e-28 Identity = 66/72 (91.67%), Postives = 69/72 (95.83%), Query Frame = 0
BLAST of BhiUN533G10 vs. TrEMBL
Match: tr|A0A1S3AWS8|A0A1S3AWS8_CUCME (enoyl-CoA delta isomerase 2, peroxisomal-like OS=Cucumis melo OX=3656 GN=LOC103483623 PE=4 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 5.0e-28 Identity = 66/72 (91.67%), Postives = 69/72 (95.83%), Query Frame = 0
BLAST of BhiUN533G10 vs. TrEMBL
Match: tr|A0A0A0L9X4|A0A0A0L9X4_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G141770 PE=4 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 1.3e-23 Identity = 58/72 (80.56%), Postives = 64/72 (88.89%), Query Frame = 0
BLAST of BhiUN533G10 vs. TrEMBL
Match: tr|A0A0A0L566|A0A0A0L566_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G141790 PE=4 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 1.8e-22 Identity = 56/72 (77.78%), Postives = 63/72 (87.50%), Query Frame = 0
BLAST of BhiUN533G10 vs. TrEMBL
Match: tr|A0A1S3AWB3|A0A1S3AWB3_CUCME (enoyl-CoA delta isomerase 2, peroxisomal-like OS=Cucumis melo OX=3656 GN=LOC103483618 PE=4 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 2.0e-21 Identity = 57/72 (79.17%), Postives = 62/72 (86.11%), Query Frame = 0
BLAST of BhiUN533G10 vs. NCBI nr
Match: XP_004134080.1 (PREDICTED: 3-hydroxybutyryl-CoA dehydratase-like protein, mitochondrial [Cucumis sativus] >KGN56882.1 hypothetical protein Csa_3G141780 [Cucumis sativus]) HSP 1 Score: 132.9 bits (333), Expect = 4.4e-28 Identity = 66/72 (91.67%), Postives = 69/72 (95.83%), Query Frame = 0
BLAST of BhiUN533G10 vs. NCBI nr
Match: XP_008438558.1 (PREDICTED: enoyl-CoA delta isomerase 2, peroxisomal-like [Cucumis melo]) HSP 1 Score: 132.1 bits (331), Expect = 7.5e-28 Identity = 66/72 (91.67%), Postives = 69/72 (95.83%), Query Frame = 0
BLAST of BhiUN533G10 vs. NCBI nr
Match: XP_022980470.1 (enoyl-CoA delta isomerase 2, peroxisomal-like [Cucurbita maxima]) HSP 1 Score: 128.3 bits (321), Expect = 1.1e-26 Identity = 64/72 (88.89%), Postives = 67/72 (93.06%), Query Frame = 0
BLAST of BhiUN533G10 vs. NCBI nr
Match: XP_022924233.1 (enoyl-CoA delta isomerase 2, peroxisomal-like [Cucurbita moschata]) HSP 1 Score: 124.0 bits (310), Expect = 2.0e-25 Identity = 62/72 (86.11%), Postives = 65/72 (90.28%), Query Frame = 0
BLAST of BhiUN533G10 vs. NCBI nr
Match: XP_023526034.1 (enoyl-CoA delta isomerase 2, peroxisomal-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 124.0 bits (310), Expect = 2.0e-25 Identity = 62/72 (86.11%), Postives = 65/72 (90.28%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|