BhiUN425G40 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTGAAGAATGCAGAGGTAAAAGACATTTTAATGTTTGTTCTTATTTCAAACGTAATTTTCATATCATCAAATATTAATTTTGAATGATAGATAAAATATATTTATTTAACAATTTCAAAATTACTCTCGAACATGCTAATTTGTCGACGACATATCTCTTAGGTAAGAGTGCATGGCCGGAGTTGGTCGGTCGACTGGGAAAGGATGCCGAGAAAATTATCGAGAAGGAGAATCCTCTAGTGAATGCTGAGATCGTCGATGAAGGATCATCTGTGCTTCTTGACTTTAGGTGCGATTGGGTTTGGGTTTGGGTGGATAAGAAAACAGGCATCGTCACAAGAACTCCTATTATTGGTTAA ATGTCTGAAGAATGCAGAGGTAAGAGTGCATGGCCGGAGTTGGTCGGTCGACTGGGAAAGGATGCCGAGAAAATTATCGAGAAGGAGAATCCTCTAGTGAATGCTGAGATCGTCGATGAAGGATCATCTGTGCTTCTTGACTTTAGGTGCGATTGGGTTTGGGTTTGGGTGGATAAGAAAACAGGCATCGTCACAAGAACTCCTATTATTGGTTAA ATGTCTGAAGAATGCAGAGGTAAGAGTGCATGGCCGGAGTTGGTCGGTCGACTGGGAAAGGATGCCGAGAAAATTATCGAGAAGGAGAATCCTCTAGTGAATGCTGAGATCGTCGATGAAGGATCATCTGTGCTTCTTGACTTTAGGTGCGATTGGGTTTGGGTTTGGGTGGATAAGAAAACAGGCATCGTCACAAGAACTCCTATTATTGGTTAA MSEECRGKSAWPELVGRLGKDAEKIIEKENPLVNAEIVDEGSSVLLDFRCDWVWVWVDKKTGIVTRTPIIG
BLAST of BhiUN425G40 vs. TAIR10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 70.9 bits (172), Expect = 3.7e-13 Identity = 37/71 (52.11%), Postives = 46/71 (64.79%), Query Frame = 0
BLAST of BhiUN425G40 vs. TAIR10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 67.4 bits (163), Expect = 4.1e-12 Identity = 33/65 (50.77%), Postives = 47/65 (72.31%), Query Frame = 0
BLAST of BhiUN425G40 vs. TAIR10
Match: AT5G43570.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 50.8 bits (120), Expect = 3.9e-07 Identity = 30/75 (40.00%), Postives = 42/75 (56.00%), Query Frame = 0
BLAST of BhiUN425G40 vs. TAIR10
Match: AT3G46860.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 47.0 bits (110), Expect = 5.7e-06 Identity = 26/64 (40.62%), Postives = 39/64 (60.94%), Query Frame = 0
BLAST of BhiUN425G40 vs. Swiss-Prot
Match: sp|P24076|BGIA_MOMCH (Glu S.griseus protease inhibitor OS=Momordica charantia OX=3673 PE=1 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 7.1e-14 Identity = 38/68 (55.88%), Postives = 47/68 (69.12%), Query Frame = 0
BLAST of BhiUN425G40 vs. Swiss-Prot
Match: sp|P80211|ATSI_AMACA (Trypsin/subtilisin inhibitor OS=Amaranthus caudatus OX=3567 PE=1 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.0e-12 Identity = 37/67 (55.22%), Postives = 42/67 (62.69%), Query Frame = 0
BLAST of BhiUN425G40 vs. Swiss-Prot
Match: sp|P19873|ITH5_CUCMA (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 3.9e-12 Identity = 35/67 (52.24%), Postives = 47/67 (70.15%), Query Frame = 0
BLAST of BhiUN425G40 vs. Swiss-Prot
Match: sp|P82381|ICI_LINUS (Proteinase inhibitor OS=Linum usitatissimum OX=4006 PE=1 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.1e-11 Identity = 35/69 (50.72%), Postives = 46/69 (66.67%), Query Frame = 0
BLAST of BhiUN425G40 vs. Swiss-Prot
Match: sp|Q00783|ICI1_SOLTU (Proteinase inhibitor 1 OS=Solanum tuberosum OX=4113 PE=3 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.2e-08 Identity = 33/69 (47.83%), Postives = 43/69 (62.32%), Query Frame = 0
BLAST of BhiUN425G40 vs. TrEMBL
Match: tr|A0A0A0L795|A0A0A0L795_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142960 PE=4 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 2.1e-23 Identity = 54/71 (76.06%), Postives = 59/71 (83.10%), Query Frame = 0
BLAST of BhiUN425G40 vs. TrEMBL
Match: tr|A0A1S4DTF7|A0A1S4DTF7_CUCME (inhibitor of trypsin and hageman factor-like OS=Cucumis melo OX=3656 GN=LOC103483638 PE=4 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 1.4e-19 Identity = 49/71 (69.01%), Postives = 56/71 (78.87%), Query Frame = 0
BLAST of BhiUN425G40 vs. TrEMBL
Match: tr|A0A0A0L4J0|A0A0A0L4J0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142970 PE=4 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 7.1e-19 Identity = 49/71 (69.01%), Postives = 55/71 (77.46%), Query Frame = 0
BLAST of BhiUN425G40 vs. TrEMBL
Match: tr|G7I4R6|G7I4R6_MEDTR (Inhibitor of trypsin and hageman factor-like protein OS=Medicago truncatula OX=3880 GN=11429575 PE=4 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 1.2e-18 Identity = 49/69 (71.01%), Postives = 56/69 (81.16%), Query Frame = 0
BLAST of BhiUN425G40 vs. TrEMBL
Match: tr|V7BDZ6|V7BDZ6_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris OX=3885 GN=PHAVU_007G125500g PE=4 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 1.2e-18 Identity = 49/71 (69.01%), Postives = 57/71 (80.28%), Query Frame = 0
BLAST of BhiUN425G40 vs. NCBI nr
Match: XP_004134090.1 (PREDICTED: glu S.griseus protease inhibitor-like [Cucumis sativus] >KGN56904.1 hypothetical protein Csa_3G142960 [Cucumis sativus]) HSP 1 Score: 116.7 bits (291), Expect = 3.2e-23 Identity = 54/71 (76.06%), Postives = 59/71 (83.10%), Query Frame = 0
BLAST of BhiUN425G40 vs. NCBI nr
Match: XP_016898985.1 (PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis melo]) HSP 1 Score: 104.0 bits (258), Expect = 2.2e-19 Identity = 49/71 (69.01%), Postives = 56/71 (78.87%), Query Frame = 0
BLAST of BhiUN425G40 vs. NCBI nr
Match: KGN56905.1 (hypothetical protein Csa_3G142970 [Cucumis sativus]) HSP 1 Score: 101.7 bits (252), Expect = 1.1e-18 Identity = 49/71 (69.01%), Postives = 55/71 (77.46%), Query Frame = 0
BLAST of BhiUN425G40 vs. NCBI nr
Match: RDX74039.1 (hypothetical protein CR513_46248, partial [Mucuna pruriens]) HSP 1 Score: 101.7 bits (252), Expect = 1.1e-18 Identity = 49/71 (69.01%), Postives = 58/71 (81.69%), Query Frame = 0
BLAST of BhiUN425G40 vs. NCBI nr
Match: XP_007144065.1 (hypothetical protein PHAVU_007G125500g [Phaseolus vulgaris] >ESW16059.1 hypothetical protein PHAVU_007G125500g [Phaseolus vulgaris]) HSP 1 Score: 100.9 bits (250), Expect = 1.8e-18 Identity = 49/71 (69.01%), Postives = 57/71 (80.28%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|