BhiUN425G32 (gene) Wax gourd
The following sequences are available for this feature:
Legend: five_prime_UTRexonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.CCCAAACAGAGAGAGAGAGAGAGAAAAATCGAACGAAAAACCTCTATCAATACAGCCAAGGATGTCTACAACATGCAAAGGTACATGAGTAAAATAACATCATTAAGCCCATGATCACGTTCGGTTTTTTGAAATTGTACTTGCTTTTTTTTTACTATTTTTTACAATGATTTAAAAATTACAGTCTCATTATTTTTAATTTTTGAAAATTAAATTTATAAACTACACTATTTTATCTAAACTTTAATCCCGTCAAGCTTTAATCTCGTCAGCACCACATCAAACAATAAAACCGGAATTAATGTATGGTTTTTTAATGTTGCAACGTTTAGGAAAGAGTTCATGGCCGGAATTGGTTGGGAAGGAAGGAAAAGAAGCAGAGAAGATTATTGAGAAGGAGAATCCATTGGTTGATGCAATTATTGTTGATGAAGGATCAATGGTGACTCTAGATTTTAGGTGCGATAGGGTTTGGGTTTGGGTGGCTAAGAAAACAGGCATTGTCACCAGGACTCCTTTCATTGGTTAA CCCAAACAGAGAGAGAGAGAGAGAAAAATCGAACGAAAAACCTCTATCAATACAGCCAAGGATGTCTACAACATGCAAAGGAAAGAGTTCATGGCCGGAATTGGTTGGGAAGGAAGGAAAAGAAGCAGAGAAGATTATTGAGAAGGAGAATCCATTGGTTGATGCAATTATTGTTGATGAAGGATCAATGGTGACTCTAGATTTTAGGTGCGATAGGGTTTGGGTTTGGGTGGCTAAGAAAACAGGCATTGTCACCAGGACTCCTTTCATTGGTTAA ATGTCTACAACATGCAAAGGAAAGAGTTCATGGCCGGAATTGGTTGGGAAGGAAGGAAAAGAAGCAGAGAAGATTATTGAGAAGGAGAATCCATTGGTTGATGCAATTATTGTTGATGAAGGATCAATGGTGACTCTAGATTTTAGGTGCGATAGGGTTTGGGTTTGGGTGGCTAAGAAAACAGGCATTGTCACCAGGACTCCTTTCATTGGTTAA MSTTCKGKSSWPELVGKEGKEAEKIIEKENPLVDAIIVDEGSMVTLDFRCDRVWVWVAKKTGIVTRTPFIG
BLAST of BhiUN425G32 vs. TAIR10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 72.8 bits (177), Expect = 9.7e-14 Identity = 38/71 (53.52%), Postives = 47/71 (66.20%), Query Frame = 0
BLAST of BhiUN425G32 vs. TAIR10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 72.8 bits (177), Expect = 9.7e-14 Identity = 35/73 (47.95%), Postives = 54/73 (73.97%), Query Frame = 0
BLAST of BhiUN425G32 vs. TAIR10
Match: AT2G38900.2 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 58.2 bits (139), Expect = 2.5e-09 Identity = 29/65 (44.62%), Postives = 40/65 (61.54%), Query Frame = 0
BLAST of BhiUN425G32 vs. TAIR10
Match: AT3G46860.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 52.4 bits (124), Expect = 1.4e-07 Identity = 29/64 (45.31%), Postives = 39/64 (60.94%), Query Frame = 0
BLAST of BhiUN425G32 vs. TAIR10
Match: AT5G43570.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 51.6 bits (122), Expect = 2.3e-07 Identity = 31/74 (41.89%), Postives = 39/74 (52.70%), Query Frame = 0
BLAST of BhiUN425G32 vs. Swiss-Prot
Match: sp|P24076|BGIA_MOMCH (Glu S.griseus protease inhibitor OS=Momordica charantia OX=3673 PE=1 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 9.9e-16 Identity = 41/67 (61.19%), Postives = 49/67 (73.13%), Query Frame = 0
BLAST of BhiUN425G32 vs. Swiss-Prot
Match: sp|P19873|ITH5_CUCMA (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 1.9e-14 Identity = 38/69 (55.07%), Postives = 51/69 (73.91%), Query Frame = 0
BLAST of BhiUN425G32 vs. Swiss-Prot
Match: sp|P82381|ICI_LINUS (Proteinase inhibitor OS=Linum usitatissimum OX=4006 PE=1 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 7.1e-14 Identity = 37/69 (53.62%), Postives = 46/69 (66.67%), Query Frame = 0
BLAST of BhiUN425G32 vs. Swiss-Prot
Match: sp|P80211|ATSI_AMACA (Trypsin/subtilisin inhibitor OS=Amaranthus caudatus OX=3567 PE=1 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.2e-13 Identity = 38/64 (59.38%), Postives = 44/64 (68.75%), Query Frame = 0
BLAST of BhiUN425G32 vs. Swiss-Prot
Match: sp|P86971|ITI_FAGTA (Trypsin inhibitor OS=Fagopyrum tataricum OX=62330 PE=1 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 6.2e-10 Identity = 34/72 (47.22%), Postives = 44/72 (61.11%), Query Frame = 0
BLAST of BhiUN425G32 vs. TrEMBL
Match: tr|A0A0A0L795|A0A0A0L795_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142960 PE=4 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 1.3e-28 Identity = 63/71 (88.73%), Postives = 65/71 (91.55%), Query Frame = 0
BLAST of BhiUN425G32 vs. TrEMBL
Match: tr|A0A1S4DTF7|A0A1S4DTF7_CUCME (inhibitor of trypsin and hageman factor-like OS=Cucumis melo OX=3656 GN=LOC103483638 PE=4 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 3.8e-20 Identity = 51/71 (71.83%), Postives = 55/71 (77.46%), Query Frame = 0
BLAST of BhiUN425G32 vs. TrEMBL
Match: tr|A0A0A0L4J0|A0A0A0L4J0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142970 PE=4 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 4.9e-20 Identity = 51/71 (71.83%), Postives = 55/71 (77.46%), Query Frame = 0
BLAST of BhiUN425G32 vs. TrEMBL
Match: tr|A0A2P4L0Z7|A0A2P4L0Z7_QUESU (Glu s.griseus protease inhibitor OS=Quercus suber OX=58331 GN=CFP56_44653 PE=4 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 8.4e-20 Identity = 50/71 (70.42%), Postives = 58/71 (81.69%), Query Frame = 0
BLAST of BhiUN425G32 vs. TrEMBL
Match: tr|U5G1C3|U5G1C3_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_010G075200v3 PE=4 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 1.1e-19 Identity = 51/69 (73.91%), Postives = 57/69 (82.61%), Query Frame = 0
BLAST of BhiUN425G32 vs. NCBI nr
Match: XP_004134090.1 (PREDICTED: glu S.griseus protease inhibitor-like [Cucumis sativus] >KGN56904.1 hypothetical protein Csa_3G142960 [Cucumis sativus]) HSP 1 Score: 134.0 bits (336), Expect = 1.9e-28 Identity = 63/71 (88.73%), Postives = 65/71 (91.55%), Query Frame = 0
BLAST of BhiUN425G32 vs. NCBI nr
Match: XP_020966911.1 (glu S.griseus protease inhibitor-like [Arachis ipaensis] >XP_025677502.1 glu S.griseus protease inhibitor-like [Arachis hypogaea]) HSP 1 Score: 106.7 bits (265), Expect = 3.3e-20 Identity = 52/71 (73.24%), Postives = 57/71 (80.28%), Query Frame = 0
BLAST of BhiUN425G32 vs. NCBI nr
Match: XP_016898985.1 (PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis melo]) HSP 1 Score: 105.9 bits (263), Expect = 5.7e-20 Identity = 51/71 (71.83%), Postives = 55/71 (77.46%), Query Frame = 0
BLAST of BhiUN425G32 vs. NCBI nr
Match: KGN56905.1 (hypothetical protein Csa_3G142970 [Cucumis sativus]) HSP 1 Score: 105.5 bits (262), Expect = 7.4e-20 Identity = 51/71 (71.83%), Postives = 55/71 (77.46%), Query Frame = 0
BLAST of BhiUN425G32 vs. NCBI nr
Match: XP_020987874.1 (glu S.griseus protease inhibitor-like [Arachis duranensis]) HSP 1 Score: 104.8 bits (260), Expect = 1.3e-19 Identity = 51/71 (71.83%), Postives = 57/71 (80.28%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|