Bhi12G001575 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAAGGGCTGTATTTGCCAGAGAATTGGGAGTTCCTATCGTAATGCATGACTACTTAACAGGTGGATTCACTGCAAATACTAGCTTGGCTCATTATTGCCAAGATAATGGTCTACTTCTTCACATTCACCGTGCAATGCATGCCGTTATTGATAGAAAGAAGAATCATGGTATGCACTTCCGTGTACTAGCTAAAGCGTTACGTATGTCTGGTGGAACCATATTCACCTGGTACCGTAGTAGGTAA ATGAAAAGGGCTGTATTTGCCAGAGAATTGGGAGTTCCTATCGTAATGCATGACTACTTAACAGGTGGATTCACTGCAAATACTAGCTTGGCTCATTATTGCCAAGATAATGGTCTACTTCTTCACATTCACCGTGCAATGCATGCCGTTATTGATAGAAAGAAGAATCATGGTATGCACTTCCGTGTACTAGCTAAAGCGTTACGTATGTCTGGTGGAACCATATTCACCTGGTACCGTAGTAGGTAA ATGAAAAGGGCTGTATTTGCCAGAGAATTGGGAGTTCCTATCGTAATGCATGACTACTTAACAGGTGGATTCACTGCAAATACTAGCTTGGCTCATTATTGCCAAGATAATGGTCTACTTCTTCACATTCACCGTGCAATGCATGCCGTTATTGATAGAAAGAAGAATCATGGTATGCACTTCCGTGTACTAGCTAAAGCGTTACGTATGTCTGGTGGAACCATATTCACCTGGTACCGTAGTAGGTAA MKRAVFARELGVPIVMHDYLTGGFTANTSLAHYCQDNGLLLHIHRAMHAVIDRKKNHGMHFRVLAKALRMSGGTIFTWYRSR
BLAST of Bhi12G001575 vs. Swiss-Prot
Match: sp|P24680|RBL_AFRGR (Ribulose bisphosphate carboxylase large chain OS=Afrocarpus gracilior OX=56897 GN=rbcL PE=3 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 9.9e-36 Identity = 71/73 (97.26%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of Bhi12G001575 vs. Swiss-Prot
Match: sp|Q37192|RBL_BARSO (Ribulose bisphosphate carboxylase large chain OS=Bartlettina sordida OX=13517 GN=rbcL PE=3 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 9.9e-36 Identity = 71/73 (97.26%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of Bhi12G001575 vs. Swiss-Prot
Match: sp|Q31738|RBL_BREMA (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Brexia madagascariensis OX=39394 GN=rbcL PE=3 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 9.9e-36 Identity = 71/73 (97.26%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of Bhi12G001575 vs. Swiss-Prot
Match: sp|Q06023|RBL_CARCO (Ribulose bisphosphate carboxylase large chain OS=Carpinus caroliniana OX=12991 GN=rbcL PE=3 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 9.9e-36 Identity = 71/73 (97.26%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of Bhi12G001575 vs. Swiss-Prot
Match: sp|P28259|RBL_DRYSU (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Drymophloeus subdistichus OX=4716 GN=rbcL PE=3 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 9.9e-36 Identity = 71/73 (97.26%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of Bhi12G001575 vs. TAIR10
Match: ATCG00490.1 (ribulose-bisphosphate carboxylases) HSP 1 Score: 146.4 bits (368), Expect = 7.9e-36 Identity = 68/73 (93.15%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of Bhi12G001575 vs. TAIR10
Match: AT2G07732.1 (Ribulose bisphosphate carboxylase large chain, catalytic domain) HSP 1 Score: 67.4 bits (163), Expect = 4.7e-12 Identity = 31/32 (96.88%), Postives = 32/32 (100.00%), Query Frame = 0
BLAST of Bhi12G001575 vs. TAIR10
Match: ATMG00280.1 (Ribulose bisphosphate carboxylase large chain, catalytic domain) HSP 1 Score: 44.3 bits (103), Expect = 4.3e-05 Identity = 20/23 (86.96%), Postives = 21/23 (91.30%), Query Frame = 0
BLAST of Bhi12G001575 vs. TrEMBL
Match: tr|V5IXL9|V5IXL9_CAMSI (Ribulose bisphosphate carboxylase large chain OS=Camellia sinensis var. assamica OX=261999 GN=rbcL PE=3 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 2.0e-33 Identity = 71/73 (97.26%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of Bhi12G001575 vs. TrEMBL
Match: tr|I3NRZ4|I3NRZ4_9ASPA (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Cephalanthera erecta OX=814926 GN=rbcL PE=3 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 2.0e-33 Identity = 71/73 (97.26%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of Bhi12G001575 vs. TrEMBL
Match: tr|A0A290YVY2|A0A290YVY2_9ROSI (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Turpinia montana OX=1679342 GN=rbcL PE=3 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 2.0e-33 Identity = 71/73 (97.26%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of Bhi12G001575 vs. TrEMBL
Match: tr|A0A0S1TLB2|A0A0S1TLB2_9ARAE (Ribulose bisphosphate carboxylase large chain OS=Arisaema amurense OX=227494 GN=rbcL PE=3 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 2.0e-33 Identity = 71/73 (97.26%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of Bhi12G001575 vs. TrEMBL
Match: tr|A0A068FQX1|A0A068FQX1_9ASPA (Ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit (Fragment) OS=Eulophia hians var. hians OX=1386252 GN=rbcL PE=4 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 2.0e-33 Identity = 71/73 (97.26%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of Bhi12G001575 vs. NCBI nr
Match: CAC16603.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Ixora valetoniana]) HSP 1 Score: 150.2 bits (378), Expect = 3.0e-33 Identity = 71/73 (97.26%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of Bhi12G001575 vs. NCBI nr
Match: CAC83854.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Iris dichotoma]) HSP 1 Score: 150.2 bits (378), Expect = 3.0e-33 Identity = 71/73 (97.26%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of Bhi12G001575 vs. NCBI nr
Match: CAB08878.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Goodia lotifolia]) HSP 1 Score: 150.2 bits (378), Expect = 3.0e-33 Identity = 71/73 (97.26%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of Bhi12G001575 vs. NCBI nr
Match: BAA18992.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Stauntonia hexaphylla]) HSP 1 Score: 150.2 bits (378), Expect = 3.0e-33 Identity = 71/73 (97.26%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of Bhi12G001575 vs. NCBI nr
Match: AAL60333.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Camellia sinensis]) HSP 1 Score: 150.2 bits (378), Expect = 3.0e-33 Identity = 71/73 (97.26%), Postives = 73/73 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |