Bhi12G001527 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGTTGATGGAATTTAAAGACCTTCAAGTTTCTGTTATGCCTAAGGCTGAGGGAACGGAGTACCAAGCTTCTACTATGTGGTCGCCGTTCGTGGCAGCGACTAACCGGATTGATGTTCATCAGCCGCATGTTCCTAGCTTTGTGGTTGGAGGACACACTGTCAGGTAA ATGGTGTTGATGGAATTTAAAGACCTTCAAGTTTCTGTTATGCCTAAGGCTGAGGGAACGGAGTACCAAGCTTCTACTATGTGGTCGCCGTTCGTGGCAGCGACTAACCGGATTGATGTTCATCAGCCGCATGTTCCTAGCTTTGTGGTTGGAGGACACACTGTCAGGTAA ATGGTGTTGATGGAATTTAAAGACCTTCAAGTTTCTGTTATGCCTAAGGCTGAGGGAACGGAGTACCAAGCTTCTACTATGTGGTCGCCGTTCGTGGCAGCGACTAACCGGATTGATGTTCATCAGCCGCATGTTCCTAGCTTTGTGGTTGGAGGACACACTGTCAGGTAA MVLMEFKDLQVSVMPKAEGTEYQASTMWSPFVAATNRIDVHQPHVPSFVVGGHTVR
BLAST of Bhi12G001527 vs. Swiss-Prot
Match: sp|Q43077|AMO_PEA (Primary amine oxidase OS=Pisum sativum OX=3888 PE=1 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 3.6e-05 Identity = 21/55 (38.18%), Postives = 30/55 (54.55%), Query Frame = 0
BLAST of Bhi12G001527 vs. TAIR10
Match: AT1G31710.1 (Copper amine oxidase family protein) HSP 1 Score: 46.2 bits (108), Expect = 7.6e-06 Identity = 25/56 (44.64%), Postives = 30/56 (53.57%), Query Frame = 0
BLAST of Bhi12G001527 vs. TAIR10
Match: AT1G31690.1 (Copper amine oxidase family protein) HSP 1 Score: 43.5 bits (101), Expect = 5.0e-05 Identity = 23/56 (41.07%), Postives = 28/56 (50.00%), Query Frame = 0
BLAST of Bhi12G001527 vs. TrEMBL
Match: tr|A0A0A0KI34|A0A0A0KI34_CUCSA (Amine oxidase OS=Cucumis sativus OX=3659 GN=Csa_6G423980 PE=3 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 2.3e-12 Identity = 40/55 (72.73%), Postives = 44/55 (80.00%), Query Frame = 0
BLAST of Bhi12G001527 vs. TrEMBL
Match: tr|A0A1S3BN73|A0A1S3BN73_CUCME (Amine oxidase OS=Cucumis melo OX=3656 GN=LOC103491401 PE=3 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 3.9e-12 Identity = 40/55 (72.73%), Postives = 43/55 (78.18%), Query Frame = 0
BLAST of Bhi12G001527 vs. TrEMBL
Match: tr|A0A2N9FJF2|A0A2N9FJF2_FAGSY (Amine oxidase OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS15042 PE=3 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 8.4e-07 Identity = 28/55 (50.91%), Postives = 37/55 (67.27%), Query Frame = 0
BLAST of Bhi12G001527 vs. TrEMBL
Match: tr|A0A2P4KIA3|A0A2P4KIA3_QUESU (Amine oxidase OS=Quercus suber OX=58331 GN=CFP56_17857 PE=3 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 3.0e-04 Identity = 25/50 (50.00%), Postives = 33/50 (66.00%), Query Frame = 0
BLAST of Bhi12G001527 vs. TrEMBL
Match: tr|A0A072UUP2|A0A072UUP2_MEDTR (Amine oxidase OS=Medicago truncatula OX=3880 GN=25492054 PE=3 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 6.6e-04 Identity = 23/55 (41.82%), Postives = 34/55 (61.82%), Query Frame = 0
BLAST of Bhi12G001527 vs. NCBI nr
Match: XP_011657569.1 (PREDICTED: primary amine oxidase-like [Cucumis sativus] >KGN48007.1 hypothetical protein Csa_6G423980 [Cucumis sativus]) HSP 1 Score: 79.7 bits (195), Expect = 3.4e-12 Identity = 40/55 (72.73%), Postives = 44/55 (80.00%), Query Frame = 0
BLAST of Bhi12G001527 vs. NCBI nr
Match: XP_008449551.2 (PREDICTED: primary amine oxidase-like [Cucumis melo]) HSP 1 Score: 79.0 bits (193), Expect = 5.9e-12 Identity = 40/55 (72.73%), Postives = 43/55 (78.18%), Query Frame = 0
BLAST of Bhi12G001527 vs. NCBI nr
Match: XP_022138388.1 (primary amine oxidase-like [Momordica charantia]) HSP 1 Score: 70.1 bits (170), Expect = 2.7e-09 Identity = 33/55 (60.00%), Postives = 42/55 (76.36%), Query Frame = 0
BLAST of Bhi12G001527 vs. NCBI nr
Match: XP_022930469.1 (primary amine oxidase-like [Cucurbita moschata]) HSP 1 Score: 65.9 bits (159), Expect = 5.1e-08 Identity = 32/55 (58.18%), Postives = 42/55 (76.36%), Query Frame = 0
BLAST of Bhi12G001527 vs. NCBI nr
Match: XP_023515155.1 (primary amine oxidase-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 65.9 bits (159), Expect = 5.1e-08 Identity = 33/55 (60.00%), Postives = 42/55 (76.36%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |