Bhi12G001330 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCCATCTTTAAGACTCCCTTCAGTGGCTACTCCATCAAGTTTAACCCCTTCTACAAATCCCGCATCGCCGTTGCCACCACTCAAAATTTCGAAATCCTTGGTAATGGTCGCCTTCACGTCCTCGATATCAATCCTGCCGGTCCCATATCCGAGCACATCGCCTTCGACACCATCGATGGAGTCTACGACGTCTCATGA ATGCCCATCTTTAAGACTCCCTTCAGTGGCTACTCCATCAAGTTTAACCCCTTCTACAAATCCCGCATCGCCGTTGCCACCACTCAAAATTTCGAAATCCTTGGTAATGGTCGCCTTCACGTCCTCGATATCAATCCTGCCGGTCCCATATCCGAGCACATCGCCTTCGACACCATCGATGGAGTCTACGACGTCTCATGA ATGCCCATCTTTAAGACTCCCTTCAGTGGCTACTCCATCAAGTTTAACCCCTTCTACAAATCCCGCATCGCCGTTGCCACCACTCAAAATTTCGAAATCCTTGGTAATGGTCGCCTTCACGTCCTCGATATCAATCCTGCCGGTCCCATATCCGAGCACATCGCCTTCGACACCATCGATGGAGTCTACGACGTCTCATGA MPIFKTPFSGYSIKFNPFYKSRIAVATTQNFEILGNGRLHVLDINPAGPISEHIAFDTIDGVYDVS
BLAST of Bhi12G001330 vs. Swiss-Prot
Match: sp|Q9XF57|PEX7_ARATH (Peroxisome biogenesis protein 7 OS=Arabidopsis thaliana OX=3702 GN=PEX7 PE=1 SV=2) HSP 1 Score: 99.0 bits (245), Expect = 2.1e-20 Identity = 42/66 (63.64%), Postives = 56/66 (84.85%), Query Frame = 0
BLAST of Bhi12G001330 vs. Swiss-Prot
Match: sp|O59894|PEX7_PICPA (Peroxisomal targeting signal 2 receptor OS=Komagataella pastoris OX=4922 GN=PEX7 PE=3 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 3.1e-11 Identity = 29/59 (49.15%), Postives = 46/59 (77.97%), Query Frame = 0
BLAST of Bhi12G001330 vs. Swiss-Prot
Match: sp|Q54WA3|PEX7_DICDI (Peroxisomal targeting signal 2 receptor OS=Dictyostelium discoideum OX=44689 GN=pex7 PE=3 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 3.7e-09 Identity = 29/64 (45.31%), Postives = 43/64 (67.19%), Query Frame = 0
BLAST of Bhi12G001330 vs. Swiss-Prot
Match: sp|P39108|PEX7_YEAST (Peroxisomal targeting signal 2 receptor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PEX7 PE=1 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 1.9e-08 Identity = 25/59 (42.37%), Postives = 44/59 (74.58%), Query Frame = 0
BLAST of Bhi12G001330 vs. Swiss-Prot
Match: sp|O00628|PEX7_HUMAN (Peroxisomal targeting signal 2 receptor OS=Homo sapiens OX=9606 GN=PEX7 PE=1 SV=1) HSP 1 Score: 46.2 bits (108), Expect = 1.6e-04 Identity = 23/57 (40.35%), Postives = 37/57 (64.91%), Query Frame = 0
BLAST of Bhi12G001330 vs. TAIR10
Match: AT1G29260.1 (peroxin 7) HSP 1 Score: 99.0 bits (245), Expect = 1.2e-21 Identity = 42/66 (63.64%), Postives = 56/66 (84.85%), Query Frame = 0
BLAST of Bhi12G001330 vs. TrEMBL
Match: tr|A0A0A0KKD6|A0A0A0KKD6_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G519610 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 1.5e-26 Identity = 57/66 (86.36%), Postives = 63/66 (95.45%), Query Frame = 0
BLAST of Bhi12G001330 vs. TrEMBL
Match: tr|A0A1S3AZ23|A0A1S3AZ23_CUCME (peroxisome biogenesis protein 7 OS=Cucumis melo OX=3656 GN=LOC103484448 PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 3.3e-26 Identity = 56/66 (84.85%), Postives = 63/66 (95.45%), Query Frame = 0
BLAST of Bhi12G001330 vs. TrEMBL
Match: tr|F6HMA0|F6HMA0_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VIT_10s0003g01320 PE=4 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 1.3e-22 Identity = 49/66 (74.24%), Postives = 61/66 (92.42%), Query Frame = 0
BLAST of Bhi12G001330 vs. TrEMBL
Match: tr|A5BR52|A5BR52_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VITISV_004948 PE=4 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 1.3e-22 Identity = 49/66 (74.24%), Postives = 61/66 (92.42%), Query Frame = 0
BLAST of Bhi12G001330 vs. TrEMBL
Match: tr|A0A251UQW7|A0A251UQW7_HELAN (Putative peroxin 7 OS=Helianthus annuus OX=4232 GN=PEX7 PE=4 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 2.2e-22 Identity = 50/66 (75.76%), Postives = 59/66 (89.39%), Query Frame = 0
BLAST of Bhi12G001330 vs. NCBI nr
Match: XP_004134658.1 (PREDICTED: peroxisome biogenesis protein 7 [Cucumis sativus] >KGN49309.1 hypothetical protein Csa_6G519610 [Cucumis sativus]) HSP 1 Score: 127.1 bits (318), Expect = 2.2e-26 Identity = 57/66 (86.36%), Postives = 63/66 (95.45%), Query Frame = 0
BLAST of Bhi12G001330 vs. NCBI nr
Match: XP_022926644.1 (peroxisome biogenesis protein 7 [Cucurbita moschata] >XP_023003293.1 peroxisome biogenesis protein 7 [Cucurbita maxima]) HSP 1 Score: 127.1 bits (318), Expect = 2.2e-26 Identity = 57/66 (86.36%), Postives = 63/66 (95.45%), Query Frame = 0
BLAST of Bhi12G001330 vs. NCBI nr
Match: XP_023518843.1 (peroxisome biogenesis protein 7 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 127.1 bits (318), Expect = 2.2e-26 Identity = 57/66 (86.36%), Postives = 63/66 (95.45%), Query Frame = 0
BLAST of Bhi12G001330 vs. NCBI nr
Match: XP_008439741.1 (PREDICTED: peroxisome biogenesis protein 7 [Cucumis melo]) HSP 1 Score: 125.9 bits (315), Expect = 4.9e-26 Identity = 56/66 (84.85%), Postives = 63/66 (95.45%), Query Frame = 0
BLAST of Bhi12G001330 vs. NCBI nr
Match: XP_022142148.1 (peroxisome biogenesis protein 7 [Momordica charantia]) HSP 1 Score: 122.5 bits (306), Expect = 5.5e-25 Identity = 54/66 (81.82%), Postives = 61/66 (92.42%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |