Bhi12G001160 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTGGTCCGGGTAGGAAGAAAGGAATTGAACCCAGATAAAGCCTGTTACCAGTTGCCAGAAGAATTGTCAACAAAAGAAGAAGCAGTGGTCTTTGACCAGGACCAGGAACCAATTCGAATTTGGATCTGGGGCAAATTTTGGGTGTGGGATGCTCGTTTAACCTATGTATTCATCTCGTTCCTTATTTACCTGGGTGCTCCATTCATCCGACCAGGGGTGTGGATAACGAGGCCACCTTCACAACCTTCTCCCTTCTATCCCTATGGTGTAGTAAGGTAG ATGCTGGTCCGGGTAGGAAGAAAGGAATTGAACCCAGATAAAGCCTGTTACCAGTTGCCAGAAGAATTGTCAACAAAAGAAGAAGCAGTGGTCTTTGACCAGGACCAGGAACCAATTCGAATTTGGATCTGGGGCAAATTTTGGGTGTGGGATGCTCGTTTAACCTATGTATTCATCTCGTTCCTTATTTACCTGGGTGCTCCATTCATCCGACCAGGGGTGTGGATAACGAGGCCACCTTCACAACCTTCTCCCTTCTATCCCTATGGTGTAGTAAGGTAG ATGCTGGTCCGGGTAGGAAGAAAGGAATTGAACCCAGATAAAGCCTGTTACCAGTTGCCAGAAGAATTGTCAACAAAAGAAGAAGCAGTGGTCTTTGACCAGGACCAGGAACCAATTCGAATTTGGATCTGGGGCAAATTTTGGGTGTGGGATGCTCGTTTAACCTATGTATTCATCTCGTTCCTTATTTACCTGGGTGCTCCATTCATCCGACCAGGGGTGTGGATAACGAGGCCACCTTCACAACCTTCTCCCTTCTATCCCTATGGTGTAGTAAGGTAG MLVRVGRKELNPDKACYQLPEELSTKEEAVVFDQDQEPIRIWIWGKFWVWDARLTYVFISFLIYLGAPFIRPGVWITRPPSQPSPFYPYGVVR
BLAST of Bhi12G001160 vs. Swiss-Prot
Match: sp|P92527|CCMC_ARATH (Putative cytochrome c biosynthesis ccmC-like mitochondrial protein OS=Arabidopsis thaliana OX=3702 GN=CCMC PE=2 SV=4) HSP 1 Score: 47.8 bits (112), Expect = 7.9e-05 Identity = 20/25 (80.00%), Postives = 21/25 (84.00%), Query Frame = 0
BLAST of Bhi12G001160 vs. Swiss-Prot
Match: sp|P38453|CCMC_MARPO (Putative cytochrome c biosynthesis ccmC-like mitochondrial protein OS=Marchantia polymorpha OX=3197 GN=CCMC PE=3 SV=1) HSP 1 Score: 45.4 bits (106), Expect = 3.9e-04 Identity = 19/25 (76.00%), Postives = 20/25 (80.00%), Query Frame = 0
BLAST of Bhi12G001160 vs. TAIR10
Match: AT2G07681.1 (Cytochrome C assembly protein) HSP 1 Score: 51.6 bits (122), Expect = 3.0e-07 Identity = 22/25 (88.00%), Postives = 23/25 (92.00%), Query Frame = 0
BLAST of Bhi12G001160 vs. TAIR10
Match: AT2G07771.2 (Cytochrome C assembly protein) HSP 1 Score: 51.6 bits (122), Expect = 3.0e-07 Identity = 22/25 (88.00%), Postives = 23/25 (92.00%), Query Frame = 0
BLAST of Bhi12G001160 vs. TAIR10
Match: ATMG00900.1 (cytochrome C biogenesis 256) HSP 1 Score: 51.6 bits (122), Expect = 3.0e-07 Identity = 22/25 (88.00%), Postives = 23/25 (92.00%), Query Frame = 0
BLAST of Bhi12G001160 vs. TrEMBL
Match: tr|A0A151RF24|A0A151RF24_CAJCA (Uncharacterized protein OS=Cajanus cajan OX=3821 GN=KK1_037654 PE=4 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 5.8e-05 Identity = 26/44 (59.09%), Postives = 32/44 (72.73%), Query Frame = 0
BLAST of Bhi12G001160 vs. TrEMBL
Match: tr|A0A1D6YXY4|A0A1D6YXY4_9LAMI (Putative cytochrome c biosynthesis ccmC-like mitochondrial protein OS=Castilleja paramensis OX=1857654 GN=ccmC PE=3 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 1.7e-04 Identity = 26/43 (60.47%), Postives = 31/43 (72.09%), Query Frame = 0
BLAST of Bhi12G001160 vs. TrEMBL
Match: tr|A0A141BUH2|A0A141BUH2_9LAMI (Putative cytochrome c biosynthesis ccmC-like mitochondrial protein OS=Neobartsia pedicularoides OX=691774 GN=ccmC PE=3 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 2.9e-04 Identity = 25/43 (58.14%), Postives = 31/43 (72.09%), Query Frame = 0
BLAST of Bhi12G001160 vs. TrEMBL
Match: tr|W1P966|W1P966_AMBTC (Uncharacterized protein OS=Amborella trichopoda OX=13333 GN=AMTR_s00003p00271410 PE=4 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 2.9e-04 Identity = 22/25 (88.00%), Postives = 24/25 (96.00%), Query Frame = 0
BLAST of Bhi12G001160 vs. TrEMBL
Match: tr|R4QVP7|R4QVP7_UTRGI (Putative cytochrome c biosynthesis ccmC-like mitochondrial protein OS=Utricularia gibba OX=13748 GN=ccmC PE=3 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 2.9e-04 Identity = 25/43 (58.14%), Postives = 31/43 (72.09%), Query Frame = 0
BLAST of Bhi12G001160 vs. NCBI nr
Match: KYP41005.1 (hypothetical protein KK1_037654 [Cajanus cajan]) HSP 1 Score: 55.8 bits (133), Expect = 8.8e-05 Identity = 26/44 (59.09%), Postives = 32/44 (72.73%), Query Frame = 0
BLAST of Bhi12G001160 vs. NCBI nr
Match: YP_009316402.1 (cytochrome c maturase subunit C (mitochondrion) [Castilleja paramensis] >ANJ04362.1 cytochrome c maturase subunit C (mitochondrion) [Castilleja paramensis]) HSP 1 Score: 54.3 bits (129), Expect = 2.6e-04 Identity = 26/43 (60.47%), Postives = 31/43 (72.09%), Query Frame = 0
BLAST of Bhi12G001160 vs. NCBI nr
Match: AGL75407.1 (cytochrome c biogenesis C (mitochondrion) [Utricularia gibba]) HSP 1 Score: 53.5 bits (127), Expect = 4.4e-04 Identity = 25/43 (58.14%), Postives = 31/43 (72.09%), Query Frame = 0
BLAST of Bhi12G001160 vs. NCBI nr
Match: ERN03535.1 (hypothetical protein AMTR_s00003p00271410 [Amborella trichopoda]) HSP 1 Score: 53.5 bits (127), Expect = 4.4e-04 Identity = 22/25 (88.00%), Postives = 24/25 (96.00%), Query Frame = 0
BLAST of Bhi12G001160 vs. NCBI nr
Match: AKQ51030.1 (Cytochrome c maturation subunit C (mitochondrion) [Neobartsia pedicularoides]) HSP 1 Score: 53.5 bits (127), Expect = 4.4e-04 Identity = 25/43 (58.14%), Postives = 31/43 (72.09%), Query Frame = 0
The following BLAST results are available for this feature:
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|