Bhi12G001078 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGCGTTTTGTAACCAGGGAAGAATCCAGGGCAGATGGGACTGATACTAGTAAATACCCATCTTCTTACTATAGCTCTCCAAGGTTTTCCGATGGACCTTCCAAGGAGGTAGGTTGAAAAATTATTTTAATTTTCTAAAGAACTTGGCTATTTCTTCTATTAGAAGTATATTTTCTCTTGATCTATTTCTTACCAATACACCGTGTTTAGTAGCTAGACCCGTATATGCAGAGCATGTACATCTTTTTATTTTCTTAAATTTATTTTCTTCAATGTTATCTTGTCTCTTTGGTTCCAGATGACAATTCATGTTTAGAATCCGATGGCCTATTATTCTCTTTCAGCTCAAGGAAGATATCTCAGTCCATGGTAGCGATGAAGAGGTTGATGATCCTTAA ATGCGTTTTGTAACCAGGGAAGAATCCAGGGCAGATGGGACTGATACTAGTAAATACCCATCTTCTTACTATAGCTCTCCAAGGTTTTCCGATGGACCTTCCAAGGAGCTCAAGGAAGATATCTCAGTCCATGGTAGCGATGAAGAGGTTGATGATCCTTAA ATGCGTTTTGTAACCAGGGAAGAATCCAGGGCAGATGGGACTGATACTAGTAAATACCCATCTTCTTACTATAGCTCTCCAAGGTTTTCCGATGGACCTTCCAAGGAGCTCAAGGAAGATATCTCAGTCCATGGTAGCGATGAAGAGGTTGATGATCCTTAA MRFVTREESRADGTDTSKYPSSYYSSPRFSDGPSKELKEDISVHGSDEEVDDP
BLAST of Bhi12G001078 vs. Swiss-Prot
Match: sp|Q9FJH9|LPAH1_ARATH (P-loop NTPase domain-containing protein LPA1 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=At5g60760 PE=2 SV=1) HSP 1 Score: 46.6 bits (109), Expect = 1.0e-04 Identity = 27/43 (62.79%), Postives = 33/43 (76.74%), Query Frame = 0
BLAST of Bhi12G001078 vs. Swiss-Prot
Match: sp|B9F4I8|LPA1_ORYSJ (P-loop NTPase domain-containing protein LPA1 OS=Oryza sativa subsp. japonica OX=39947 GN=LPA1 PE=2 SV=1) HSP 1 Score: 43.9 bits (102), Expect = 6.5e-04 Identity = 28/49 (57.14%), Postives = 35/49 (71.43%), Query Frame = 0
BLAST of Bhi12G001078 vs. TAIR10
Match: AT5G60760.1 (P-loop containing nucleoside triphosphate hydrolases superfamily protein) HSP 1 Score: 46.6 bits (109), Expect = 5.5e-06 Identity = 27/43 (62.79%), Postives = 33/43 (76.74%), Query Frame = 0
BLAST of Bhi12G001078 vs. TrEMBL
Match: tr|A0A1S3CNQ1|A0A1S3CNQ1_CUCME (p-loop NTPase domain-containing protein LPA1 homolog 1-like OS=Cucumis melo OX=3656 GN=LOC103502999 PE=4 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 7.4e-13 Identity = 42/47 (89.36%), Postives = 44/47 (93.62%), Query Frame = 0
BLAST of Bhi12G001078 vs. TrEMBL
Match: tr|A0A0A0KGH7|A0A0A0KGH7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G147540 PE=4 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 7.4e-13 Identity = 42/47 (89.36%), Postives = 44/47 (93.62%), Query Frame = 0
BLAST of Bhi12G001078 vs. TrEMBL
Match: tr|A0A2I4E7N9|A0A2I4E7N9_9ROSI (P-loop NTPase domain-containing protein LPA1 homolog 1-like OS=Juglans regia OX=51240 GN=LOC108987031 PE=4 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 4.5e-10 Identity = 39/48 (81.25%), Postives = 43/48 (89.58%), Query Frame = 0
BLAST of Bhi12G001078 vs. TrEMBL
Match: tr|A0A059D4W1|A0A059D4W1_EUCGR (Uncharacterized protein OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_B02534 PE=4 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.7e-09 Identity = 39/48 (81.25%), Postives = 41/48 (85.42%), Query Frame = 0
BLAST of Bhi12G001078 vs. TrEMBL
Match: tr|A0A2K3NL45|A0A2K3NL45_TRIPR (2-phosphoglycerate kinase OS=Trifolium pratense OX=57577 GN=L195_g000167 PE=4 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.7e-09 Identity = 37/47 (78.72%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of Bhi12G001078 vs. NCBI nr
Match: XP_008465362.1 (PREDICTED: P-loop NTPase domain-containing protein LPA1 homolog 1-like [Cucumis melo]) HSP 1 Score: 81.3 bits (199), Expect = 1.1e-12 Identity = 42/47 (89.36%), Postives = 44/47 (93.62%), Query Frame = 0
BLAST of Bhi12G001078 vs. NCBI nr
Match: XP_011657017.1 (PREDICTED: P-loop NTPase domain-containing protein LPA1 homolog 1 [Cucumis sativus] >KGN46861.1 hypothetical protein Csa_6G147540 [Cucumis sativus]) HSP 1 Score: 81.3 bits (199), Expect = 1.1e-12 Identity = 42/47 (89.36%), Postives = 44/47 (93.62%), Query Frame = 0
BLAST of Bhi12G001078 vs. NCBI nr
Match: XP_022958671.1 (P-loop NTPase domain-containing protein LPA1 homolog 2-like isoform X1 [Cucurbita moschata]) HSP 1 Score: 80.9 bits (198), Expect = 1.5e-12 Identity = 42/47 (89.36%), Postives = 43/47 (91.49%), Query Frame = 0
BLAST of Bhi12G001078 vs. NCBI nr
Match: XP_022958672.1 (P-loop NTPase domain-containing protein LPA1 homolog 1-like isoform X2 [Cucurbita moschata]) HSP 1 Score: 80.9 bits (198), Expect = 1.5e-12 Identity = 42/47 (89.36%), Postives = 43/47 (91.49%), Query Frame = 0
BLAST of Bhi12G001078 vs. NCBI nr
Match: XP_022996161.1 (P-loop NTPase domain-containing protein LPA1 homolog 1-like isoform X2 [Cucurbita maxima]) HSP 1 Score: 80.9 bits (198), Expect = 1.5e-12 Identity = 42/47 (89.36%), Postives = 43/47 (91.49%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|