Bhi11G002217 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCGTTTGGGAGCGGCCGCCGGAGCTGCCCCGGCGCCGCTCTGGCTCTGGTGGCGGTGCCGGCAGTTCTTGGGAGGTTGATTCAGTGCTTTGAGTGGAGGGTTGACGGCGGCAGCGGCGTTGATATGGAAGAAGGGCCTGGAATCTCTCTCCGACGAGCTCATTCCTTGGTTCTAGTCCCTGTGCCTAGGCTTCATCCTTTTCCTTCTATCTAA ATGCCGTTTGGGAGCGGCCGCCGGAGCTGCCCCGGCGCCGCTCTGGCTCTGGTGGCGGTGCCGGCAGTTCTTGGGAGGTTGATTCAGTGCTTTGAGTGGAGGGTTGACGGCGGCAGCGGCGTTGATATGGAAGAAGGGCCTGGAATCTCTCTCCGACGAGCTCATTCCTTGGTTCTAGTCCCTGTGCCTAGGCTTCATCCTTTTCCTTCTATCTAA ATGCCGTTTGGGAGCGGCCGCCGGAGCTGCCCCGGCGCCGCTCTGGCTCTGGTGGCGGTGCCGGCAGTTCTTGGGAGGTTGATTCAGTGCTTTGAGTGGAGGGTTGACGGCGGCAGCGGCGTTGATATGGAAGAAGGGCCTGGAATCTCTCTCCGACGAGCTCATTCCTTGGTTCTAGTCCCTGTGCCTAGGCTTCATCCTTTTCCTTCTATCTAA MPFGSGRRSCPGAALALVAVPAVLGRLIQCFEWRVDGGSGVDMEEGPGISLRRAHSLVLVPVPRLHPFPSI
BLAST of Bhi11G002217 vs. Swiss-Prot
Match: sp|Q42798|C93A1_SOYBN (3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max OX=3847 GN=CYP93A1 PE=1 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 4.3e-19 Identity = 43/72 (59.72%), Postives = 58/72 (80.56%), Query Frame = 0
BLAST of Bhi11G002217 vs. Swiss-Prot
Match: sp|Q42799|C93A2_SOYBN (Cytochrome P450 93A2 OS=Glycine max OX=3847 GN=CYP93A2 PE=2 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 2.1e-18 Identity = 43/70 (61.43%), Postives = 53/70 (75.71%), Query Frame = 0
BLAST of Bhi11G002217 vs. Swiss-Prot
Match: sp|O81973|C93A3_SOYBN (Cytochrome P450 93A3 OS=Glycine max OX=3847 GN=CYP93A3 PE=2 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 5.2e-17 Identity = 41/72 (56.94%), Postives = 54/72 (75.00%), Query Frame = 0
BLAST of Bhi11G002217 vs. Swiss-Prot
Match: sp|Q0JFI2|C93G1_ORYSJ (Cytochrome P450 93G1 OS=Oryza sativa subsp. japonica OX=39947 GN=CYP93G1 PE=1 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 6.8e-17 Identity = 39/71 (54.93%), Postives = 48/71 (67.61%), Query Frame = 0
BLAST of Bhi11G002217 vs. Swiss-Prot
Match: sp|Q5VRI5|C93G2_ORYSJ (Cytochrome P450 93G2 OS=Oryza sativa subsp. japonica OX=39947 GN=CYP93G2 PE=2 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 2.2e-15 Identity = 38/72 (52.78%), Postives = 47/72 (65.28%), Query Frame = 0
BLAST of Bhi11G002217 vs. TAIR10
Match: AT4G37310.1 (cytochrome P450, family 81, subfamily H, polypeptide 1) HSP 1 Score: 74.7 bits (182), Expect = 2.5e-14 Identity = 34/59 (57.63%), Postives = 41/59 (69.49%), Query Frame = 0
BLAST of Bhi11G002217 vs. TAIR10
Match: AT3G20120.1 (cytochrome P450, family 705, subfamily A, polypeptide 21) HSP 1 Score: 74.3 bits (181), Expect = 3.3e-14 Identity = 32/67 (47.76%), Postives = 44/67 (65.67%), Query Frame = 0
BLAST of Bhi11G002217 vs. TAIR10
Match: AT4G37360.1 (cytochrome P450, family 81, subfamily D, polypeptide 2) HSP 1 Score: 69.3 bits (168), Expect = 1.1e-12 Identity = 32/57 (56.14%), Postives = 38/57 (66.67%), Query Frame = 0
BLAST of Bhi11G002217 vs. TAIR10
Match: AT4G37400.1 (cytochrome P450, family 81, subfamily F, polypeptide 3) HSP 1 Score: 69.3 bits (168), Expect = 1.1e-12 Identity = 29/53 (54.72%), Postives = 37/53 (69.81%), Query Frame = 0
BLAST of Bhi11G002217 vs. TAIR10
Match: AT2G27010.1 (cytochrome P450, family 705, subfamily A, polypeptide 9) HSP 1 Score: 68.9 bits (167), Expect = 1.4e-12 Identity = 31/65 (47.69%), Postives = 45/65 (69.23%), Query Frame = 0
BLAST of Bhi11G002217 vs. TrEMBL
Match: tr|A0A1S3B6S6|A0A1S3B6S6_CUCME (3,9-dihydroxypterocarpan 6A-monooxygenase OS=Cucumis melo OX=3656 GN=LOC103486789 PE=3 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 3.7e-28 Identity = 61/71 (85.92%), Postives = 65/71 (91.55%), Query Frame = 0
BLAST of Bhi11G002217 vs. TrEMBL
Match: tr|A0A0A0LBD2|A0A0A0LBD2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G810500 PE=4 SV=1) HSP 1 Score: 131.7 bits (330), Expect = 6.4e-28 Identity = 60/71 (84.51%), Postives = 65/71 (91.55%), Query Frame = 0
BLAST of Bhi11G002217 vs. TrEMBL
Match: tr|A0A2N9F7P2|A0A2N9F7P2_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS11054 PE=3 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 8.4e-20 Identity = 51/73 (69.86%), Postives = 57/73 (78.08%), Query Frame = 0
BLAST of Bhi11G002217 vs. TrEMBL
Match: tr|A0A2N9F8R6|A0A2N9F8R6_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS11056 PE=3 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 1.1e-19 Identity = 49/71 (69.01%), Postives = 54/71 (76.06%), Query Frame = 0
BLAST of Bhi11G002217 vs. TrEMBL
Match: tr|A0A2I4G6D5|A0A2I4G6D5_9ROSI (cytochrome P450 93A3-like OS=Juglans regia OX=51240 GN=LOC109005129 PE=3 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 2.4e-19 Identity = 49/72 (68.06%), Postives = 55/72 (76.39%), Query Frame = 0
BLAST of Bhi11G002217 vs. NCBI nr
Match: XP_008443084.1 (PREDICTED: 3,9-dihydroxypterocarpan 6A-monooxygenase [Cucumis melo]) HSP 1 Score: 132.5 bits (332), Expect = 5.7e-28 Identity = 61/71 (85.92%), Postives = 65/71 (91.55%), Query Frame = 0
BLAST of Bhi11G002217 vs. NCBI nr
Match: XP_004136742.1 (PREDICTED: 3,9-dihydroxypterocarpan 6A-monooxygenase [Cucumis sativus]) HSP 1 Score: 131.7 bits (330), Expect = 9.7e-28 Identity = 60/71 (84.51%), Postives = 65/71 (91.55%), Query Frame = 0
BLAST of Bhi11G002217 vs. NCBI nr
Match: KGN59325.1 (hypothetical protein Csa_3G810500 [Cucumis sativus]) HSP 1 Score: 131.7 bits (330), Expect = 9.7e-28 Identity = 60/71 (84.51%), Postives = 65/71 (91.55%), Query Frame = 0
BLAST of Bhi11G002217 vs. NCBI nr
Match: XP_022766019.1 (3,9-dihydroxypterocarpan 6A-monooxygenase-like [Durio zibethinus]) HSP 1 Score: 104.0 bits (258), Expect = 2.2e-19 Identity = 46/71 (64.79%), Postives = 57/71 (80.28%), Query Frame = 0
BLAST of Bhi11G002217 vs. NCBI nr
Match: XP_018839466.1 (PREDICTED: cytochrome P450 93A3-like [Juglans regia]) HSP 1 Score: 103.2 bits (256), Expect = 3.7e-19 Identity = 49/72 (68.06%), Postives = 55/72 (76.39%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|