Bhi11G001562 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGTTTTGCTAATACCTCTTGTCTTCAAGAAATAGATCTTTCTCAGAATAACCTCACTGGAAAACTACTCGATGACTTGGGGAGCTTAAAGGACTTGGTGATACTCAATTTTGATGACAATATACTTGGCAGTGGAAAGGTTGATGACTTGAGTTTTATCAATTTTTTGGCCAATTGTACTGGTTTAAGTATGTTGGGTATTGCTGGGAATCATTTTGGAGGAGTATTGCCTTCATCTATTAGTTATCTTTCAAACCAGTACTCACAAGCCTAA ATGTGTTTTGCTAATACCTCTTGTCTTCAAGAAATAGATCTTTCTCAGAATAACCTCACTGGAAAACTACTCGATGACTTGGGGAGCTTAAAGGACTTGGTGATACTCAATTTTGATGACAATATACTTGGCAGTGGAAAGGTTGATGACTTGAGTTTTATCAATTTTTTGGCCAATTGTACTGGTTTAAGTATGTTGGGTATTGCTGGGAATCATTTTGGAGGAGTATTGCCTTCATCTATTAGTTATCTTTCAAACCAGTACTCACAAGCCTAA ATGTGTTTTGCTAATACCTCTTGTCTTCAAGAAATAGATCTTTCTCAGAATAACCTCACTGGAAAACTACTCGATGACTTGGGGAGCTTAAAGGACTTGGTGATACTCAATTTTGATGACAATATACTTGGCAGTGGAAAGGTTGATGACTTGAGTTTTATCAATTTTTTGGCCAATTGTACTGGTTTAAGTATGTTGGGTATTGCTGGGAATCATTTTGGAGGAGTATTGCCTTCATCTATTAGTTATCTTTCAAACCAGTACTCACAAGCCTAA MCFANTSCLQEIDLSQNNLTGKLLDDLGSLKDLVILNFDDNILGSGKVDDLSFINFLANCTGLSMLGIAGNHFGGVLPSSISYLSNQYSQA
BLAST of Bhi11G001562 vs. Swiss-Prot
Match: sp|C0LGP4|Y3475_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana OX=3702 GN=At3g47570 PE=2 SV=1) HSP 1 Score: 47.4 bits (111), Expect = 1.0e-04 Identity = 27/58 (46.55%), Postives = 33/58 (56.90%), Query Frame = 0
BLAST of Bhi11G001562 vs. TAIR10
Match: AT3G47570.1 (Leucine-rich repeat protein kinase family protein) HSP 1 Score: 47.4 bits (111), Expect = 5.6e-06 Identity = 27/58 (46.55%), Postives = 33/58 (56.90%), Query Frame = 0
BLAST of Bhi11G001562 vs. TAIR10
Match: AT3G47580.1 (Leucine-rich repeat protein kinase family protein) HSP 1 Score: 44.7 bits (104), Expect = 3.6e-05 Identity = 22/52 (42.31%), Postives = 31/52 (59.62%), Query Frame = 0
BLAST of Bhi11G001562 vs. TAIR10
Match: AT3G47090.1 (Leucine-rich repeat protein kinase family protein) HSP 1 Score: 41.6 bits (96), Expect = 3.1e-04 Identity = 22/57 (38.60%), Postives = 34/57 (59.65%), Query Frame = 0
BLAST of Bhi11G001562 vs. TrEMBL
Match: tr|A0A1S4DUI3|A0A1S4DUI3_CUCME (uncharacterized protein LOC103486310 OS=Cucumis melo OX=3656 GN=LOC103486310 PE=3 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 5.7e-13 Identity = 41/58 (70.69%), Postives = 49/58 (84.48%), Query Frame = 0
BLAST of Bhi11G001562 vs. TrEMBL
Match: tr|A0A127AVH1|A0A127AVH1_VERFO (LRR-RLK (Fragment) OS=Vernicia fordii OX=73154 PE=2 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 7.4e-13 Identity = 44/88 (50.00%), Postives = 57/88 (64.77%), Query Frame = 0
BLAST of Bhi11G001562 vs. TrEMBL
Match: tr|A0A0A0L9X2|A0A0A0L9X2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G731800 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 9.7e-13 Identity = 40/58 (68.97%), Postives = 49/58 (84.48%), Query Frame = 0
BLAST of Bhi11G001562 vs. TrEMBL
Match: tr|A0A0A0LFC3|A0A0A0LFC3_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G731860 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 9.7e-13 Identity = 41/59 (69.49%), Postives = 47/59 (79.66%), Query Frame = 0
BLAST of Bhi11G001562 vs. TrEMBL
Match: tr|A0A1S4DUI0|A0A1S4DUI0_CUCME (putative receptor-like protein kinase At3g47110 OS=Cucumis melo OX=3656 GN=LOC107990601 PE=4 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 1.1e-11 Identity = 39/59 (66.10%), Postives = 45/59 (76.27%), Query Frame = 0
BLAST of Bhi11G001562 vs. NCBI nr
Match: PQP95022.1 (putative LRR receptor-like serine/threonine-protein kinase [Prunus yedoensis var. nudiflora]) HSP 1 Score: 93.2 bits (230), Expect = 4.9e-16 Identity = 49/88 (55.68%), Postives = 64/88 (72.73%), Query Frame = 0
BLAST of Bhi11G001562 vs. NCBI nr
Match: PQM33685.1 (putative LRR receptor-like serine/threonine-protein kinase [Prunus yedoensis var. nudiflora]) HSP 1 Score: 88.6 bits (218), Expect = 1.2e-14 Identity = 47/86 (54.65%), Postives = 61/86 (70.93%), Query Frame = 0
BLAST of Bhi11G001562 vs. NCBI nr
Match: XP_022765841.1 (putative receptor-like protein kinase At3g47110 [Durio zibethinus]) HSP 1 Score: 86.7 bits (213), Expect = 4.6e-14 Identity = 46/84 (54.76%), Postives = 58/84 (69.05%), Query Frame = 0
BLAST of Bhi11G001562 vs. NCBI nr
Match: XP_021830336.1 (probable LRR receptor-like serine/threonine-protein kinase At3g47570, partial [Prunus avium]) HSP 1 Score: 86.3 bits (212), Expect = 6.0e-14 Identity = 46/83 (55.42%), Postives = 59/83 (71.08%), Query Frame = 0
BLAST of Bhi11G001562 vs. NCBI nr
Match: XP_008370142.1 (PREDICTED: putative receptor-like protein kinase At3g47110 [Malus domestica]) HSP 1 Score: 84.7 bits (208), Expect = 1.7e-13 Identity = 45/85 (52.94%), Postives = 60/85 (70.59%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |