Bhi11G000969 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATCTTCATTGGTACCTCAGGGCACTTGAGGAGGTCATCATACGCGTTCTTTCCTCGACATTTTCGATCAATGCTCATCGAATCGATGGTTTAACAGGTGTCTGGGCAGGTATTCCTTGTAGAAATTTGTATATACCATATTCCAAATGCTTTTTCTCTTCTATTTTTGTATGTAGCATATTCTAAATGCTATATTCATTCCTCGCTACTTCGACATTCGACATAACGAATTGAATTTCTTAAATGATTTTCCTTTGCAGGAGACCAGAAACTGGAAGCCATTGGAATTAGGGTATCTAAATAG ATGGATCTTCATTGGTACCTCAGGGCACTTGAGGAGGTCATCATACGCGTTCTTTCCTCGACATTTTCGATCAATGCTCATCGAATCGATGGTTTAACAGGTGTCTGGGCAGGAGACCAGAAACTGGAAGCCATTGGAATTAGGGTATCTAAATAG ATGGATCTTCATTGGTACCTCAGGGCACTTGAGGAGGTCATCATACGCGTTCTTTCCTCGACATTTTCGATCAATGCTCATCGAATCGATGGTTTAACAGGTGTCTGGGCAGGAGACCAGAAACTGGAAGCCATTGGAATTAGGGTATCTAAATAG MDLHWYLRALEEVIIRVLSSTFSINAHRIDGLTGVWAGDQKLEAIGIRVSK
BLAST of Bhi11G000969 vs. TAIR10
Match: AT4G31050.1 (Biotin/lipoate A/B protein ligase family) HSP 1 Score: 90.1 bits (222), Expect = 4.2e-19 Identity = 41/51 (80.39%), Postives = 46/51 (90.20%), Query Frame = 0
BLAST of Bhi11G000969 vs. TAIR10
Match: AT1G47578.1 (Biotin/lipoate A/B protein ligase family) HSP 1 Score: 87.0 bits (214), Expect = 3.6e-18 Identity = 39/51 (76.47%), Postives = 45/51 (88.24%), Query Frame = 0
BLAST of Bhi11G000969 vs. Swiss-Prot
Match: sp|Q948J9|LIP2P_ARATH (Octanoyltransferase LIP2p, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LIP2P PE=1 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 7.6e-18 Identity = 41/51 (80.39%), Postives = 46/51 (90.20%), Query Frame = 0
BLAST of Bhi11G000969 vs. Swiss-Prot
Match: sp|P0C7R2|LI2P2_ARATH (Octanoyltransferase LIP2p2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LIP2P2 PE=1 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 6.4e-17 Identity = 39/51 (76.47%), Postives = 45/51 (88.24%), Query Frame = 0
BLAST of Bhi11G000969 vs. Swiss-Prot
Match: sp|Q7ND22|LIPB_GLOVI (Octanoyltransferase OS=Gloeobacter violaceus (strain PCC 7421) OX=251221 GN=lipB PE=3 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 9.9e-10 Identity = 28/50 (56.00%), Postives = 37/50 (74.00%), Query Frame = 0
BLAST of Bhi11G000969 vs. Swiss-Prot
Match: sp|Q31KN6|LIPB_SYNE7 (Octanoyltransferase OS=Synechococcus elongatus (strain PCC 7942) OX=1140 GN=lipB PE=3 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 2.2e-09 Identity = 29/50 (58.00%), Postives = 38/50 (76.00%), Query Frame = 0
BLAST of Bhi11G000969 vs. Swiss-Prot
Match: sp|Q5N180|LIPB_SYNP6 (Octanoyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) OX=269084 GN=lipB PE=3 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 2.2e-09 Identity = 29/50 (58.00%), Postives = 38/50 (76.00%), Query Frame = 0
BLAST of Bhi11G000969 vs. TrEMBL
Match: tr|A0A1S4DWA5|A0A1S4DWA5_CUCME (plastidial lipoyltransferase 2-like OS=Cucumis melo OX=3656 GN=LOC103489357 PE=3 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 5.1e-19 Identity = 48/51 (94.12%), Postives = 50/51 (98.04%), Query Frame = 0
BLAST of Bhi11G000969 vs. TrEMBL
Match: tr|A0A0A0KRC7|A0A0A0KRC7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G612870 PE=3 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 5.1e-19 Identity = 48/51 (94.12%), Postives = 50/51 (98.04%), Query Frame = 0
BLAST of Bhi11G000969 vs. TrEMBL
Match: tr|B9SUW2|B9SUW2_RICCO (Lipoate-protein ligase B, putative OS=Ricinus communis OX=3988 GN=RCOM_0251400 PE=3 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 4.0e-16 Identity = 42/51 (82.35%), Postives = 47/51 (92.16%), Query Frame = 0
BLAST of Bhi11G000969 vs. TrEMBL
Match: tr|A0A2G5E9J0|A0A2G5E9J0_AQUCA (Uncharacterized protein OS=Aquilegia coerulea OX=218851 GN=AQUCO_01000365v1 PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 5.3e-16 Identity = 43/51 (84.31%), Postives = 47/51 (92.16%), Query Frame = 0
BLAST of Bhi11G000969 vs. TrEMBL
Match: tr|A0A2C9VWY5|A0A2C9VWY5_MANES (Uncharacterized protein OS=Manihot esculenta OX=3983 GN=MANES_05G166100 PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 5.3e-16 Identity = 43/51 (84.31%), Postives = 46/51 (90.20%), Query Frame = 0
BLAST of Bhi11G000969 vs. NCBI nr
Match: XP_004135053.2 (PREDICTED: plastidial lipoyltransferase 2 [Cucumis sativus] >KGN52158.1 hypothetical protein Csa_5G612870 [Cucumis sativus]) HSP 1 Score: 101.7 bits (252), Expect = 7.7e-19 Identity = 48/51 (94.12%), Postives = 50/51 (98.04%), Query Frame = 0
BLAST of Bhi11G000969 vs. NCBI nr
Match: XP_016900264.1 (PREDICTED: plastidial lipoyltransferase 2-like [Cucumis melo]) HSP 1 Score: 101.7 bits (252), Expect = 7.7e-19 Identity = 48/51 (94.12%), Postives = 50/51 (98.04%), Query Frame = 0
BLAST of Bhi11G000969 vs. NCBI nr
Match: XP_022150592.1 (plastidial lipoyltransferase 2-like [Momordica charantia] >XP_022150593.1 plastidial lipoyltransferase 2-like [Momordica charantia]) HSP 1 Score: 100.9 bits (250), Expect = 1.3e-18 Identity = 47/51 (92.16%), Postives = 50/51 (98.04%), Query Frame = 0
BLAST of Bhi11G000969 vs. NCBI nr
Match: XP_022945515.1 (plastidial lipoyltransferase 2-like [Cucurbita moschata]) HSP 1 Score: 99.0 bits (245), Expect = 5.0e-18 Identity = 47/51 (92.16%), Postives = 50/51 (98.04%), Query Frame = 0
BLAST of Bhi11G000969 vs. NCBI nr
Match: XP_023541711.1 (plastidial lipoyltransferase 2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 97.8 bits (242), Expect = 1.1e-17 Identity = 46/51 (90.20%), Postives = 50/51 (98.04%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |