Bhi11G000937 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGTGGAAGAAAATTGGATTGGTGGCTATGGTGGGGATGCTGGTGATGGCTGCTTTGGTGGAGGAGTGTGCAGCCATTGAAGCACAATCTGTGGAAGGTTTGAATAAAATTGAATTCCCAAGAAAGATGATGAAGGAAGGAAGAATGTGCCCTAGAATCCTTGAGGAGTGCACTACTGATGATGATTGCATGAATGAGTGTATTTGCCTCCCCAATGGCTTTTGTGGTTGA ATGGAGTGGAAGAAAATTGGATTGGTGGCTATGGTGGGGATGCTGGTGATGGCTGCTTTGGTGGAGGAGTGTGCAGCCATTGAAGCACAATCTGTGGAAGGTTTGAATAAAATTGAATTCCCAAGAAAGATGATGAAGGAAGGAAGAATGTGCCCTAGAATCCTTGAGGAGTGCACTACTGATGATGATTGCATGAATGAGTGTATTTGCCTCCCCAATGGCTTTTGTGGTTGA ATGGAGTGGAAGAAAATTGGATTGGTGGCTATGGTGGGGATGCTGGTGATGGCTGCTTTGGTGGAGGAGTGTGCAGCCATTGAAGCACAATCTGTGGAAGGTTTGAATAAAATTGAATTCCCAAGAAAGATGATGAAGGAAGGAAGAATGTGCCCTAGAATCCTTGAGGAGTGCACTACTGATGATGATTGCATGAATGAGTGTATTTGCCTCCCCAATGGCTTTTGTGGTTGA MEWKKIGLVAMVGMLVMAALVEECAAIEAQSVEGLNKIEFPRKMMKEGRMCPRILEECTTDDDCMNECICLPNGFCG
BLAST of Bhi11G000937 vs. Swiss-Prot
Match: sp|P34950|ITR5_LUFAE (Trypsin inhibitor 5 OS=Luffa aegyptiaca OX=3670 PE=1 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 2.2e-08 Identity = 28/63 (44.44%), Postives = 38/63 (60.32%), Query Frame = 0
BLAST of Bhi11G000937 vs. Swiss-Prot
Match: sp|Q9S8I2|ITR3_LUFAE (Trypsin inhibitor 3 OS=Luffa aegyptiaca OX=3670 PE=1 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 3.1e-07 Identity = 21/29 (72.41%), Postives = 25/29 (86.21%), Query Frame = 0
BLAST of Bhi11G000937 vs. Swiss-Prot
Match: sp|P25849|ITR1_LUFAE (Trypsin inhibitor 1 OS=Luffa aegyptiaca OX=3670 PE=1 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.6e-06 Identity = 20/29 (68.97%), Postives = 24/29 (82.76%), Query Frame = 0
BLAST of Bhi11G000937 vs. Swiss-Prot
Match: sp|P35628|ITR4_LUFAE (Trypsin inhibitor 4 OS=Luffa aegyptiaca OX=3670 PE=1 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 5.9e-06 Identity = 19/28 (67.86%), Postives = 23/28 (82.14%), Query Frame = 0
BLAST of Bhi11G000937 vs. Swiss-Prot
Match: sp|P10293|ITR3_CUCPE (Trypsin inhibitor 3 OS=Cucurbita pepo OX=3663 PE=1 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 7.7e-06 Identity = 19/31 (61.29%), Postives = 24/31 (77.42%), Query Frame = 0
BLAST of Bhi11G000937 vs. TrEMBL
Match: tr|A0A0A0KT01|A0A0A0KT01_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G000805 PE=3 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 2.6e-27 Identity = 64/79 (81.01%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of Bhi11G000937 vs. TrEMBL
Match: tr|A0A0A0KY34|A0A0A0KY34_CUCSA (Trypsin inhibitor 1 OS=Cucumis sativus OX=3659 GN=Csa_4G000810 PE=3 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 3.0e-07 Identity = 36/83 (43.37%), Postives = 50/83 (60.24%), Query Frame = 0
BLAST of Bhi11G000937 vs. NCBI nr
Match: KGN52760.1 (hypothetical protein Csa_4G000805 [Cucumis sativus]) HSP 1 Score: 129.8 bits (325), Expect = 4.0e-27 Identity = 64/79 (81.01%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of Bhi11G000937 vs. NCBI nr
Match: XP_011654311.1 (PREDICTED: uncharacterized protein LOC105435333 [Cucumis sativus]) HSP 1 Score: 129.8 bits (325), Expect = 4.0e-27 Identity = 64/79 (81.01%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of Bhi11G000937 vs. NCBI nr
Match: XP_022984819.1 (trypsin inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 82.0 bits (201), Expect = 9.5e-13 Identity = 42/81 (51.85%), Postives = 53/81 (65.43%), Query Frame = 0
BLAST of Bhi11G000937 vs. NCBI nr
Match: XP_023552845.1 (uncharacterized protein LOC111810370 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 81.3 bits (199), Expect = 1.6e-12 Identity = 40/81 (49.38%), Postives = 52/81 (64.20%), Query Frame = 0
BLAST of Bhi11G000937 vs. NCBI nr
Match: KGN52761.1 (Trypsin inhibitor 1 [Cucumis sativus]) HSP 1 Score: 63.2 bits (152), Expect = 4.6e-07 Identity = 36/83 (43.37%), Postives = 50/83 (60.24%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |