Bhi11G000768 (gene) Wax gourd
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.AGACCTTTTGGGAAAGAAGAACAGTTTCATTTATGTGATTGGAGATGGAGCTATGACAGCAGATCAAGGATATGAGGCGATGAATAATACAAGCTATCTCGATACAAACATGATCGTTATTCTCAACGACAACAAGCAAGTCTCATTGCCAACCACTACGCTTGATGTCCCTGCTACTCTTCTTGAAGCTCTTAGCAGTGCCTTAACATAA AGACCTTTTGGGAAAGAAGAACAGTTTCATTTATGTGATTGGAGATGGAGCTATGACAGCAGATCAAGGATATGAGGCGATGAATAATACAAGCTATCTCGATACAAACATGATCGTTATTCTCAACGACAACAAGCAAGTCTCATTGCCAACCACTACGCTTGATGTCCCTGCTACTCTTCTTGAAGCTCTTAGCAGTGCCTTAACATAA AGACCTTTTGGGAAAGAAGAACAGTTTCATTTATGTGATTGGAGATGGAGCTATGACAGCAGATCAAGGATATGAGGCGATGAATAATACAAGCTATCTCGATACAAACATGATCGTTATTCTCAACGACAACAAGCAAGTCTCATTGCCAACCACTACGCTTGATGTCCCTGCTACTCTTCTTGAAGCTCTTAGCAGTGCCTTAACATAA DLLGKKNSFIYVIGDGAMTADQGYEAMNNTSYLDTNMIVILNDNKQVSLPTTTLDVPATLLEALSSALT
BLAST of Bhi11G000768 vs. TAIR10
Match: AT4G15560.1 (Deoxyxylulose-5-phosphate synthase) HSP 1 Score: 93.6 bits (231), Expect = 5.1e-20 Identity = 49/69 (71.01%), Postives = 56/69 (81.16%), Query Frame = 0
BLAST of Bhi11G000768 vs. TAIR10
Match: AT3G21500.2 (1-deoxy-D-xylulose 5-phosphate synthase 1) HSP 1 Score: 87.4 bits (215), Expect = 3.7e-18 Identity = 47/69 (68.12%), Postives = 51/69 (73.91%), Query Frame = 0
BLAST of Bhi11G000768 vs. TAIR10
Match: AT5G11380.1 (1-deoxy-D-xylulose 5-phosphate synthase 3) HSP 1 Score: 52.0 bits (123), Expect = 1.7e-07 Identity = 30/69 (43.48%), Postives = 44/69 (63.77%), Query Frame = 0
BLAST of Bhi11G000768 vs. Swiss-Prot
Match: sp|Q6YU51|DXS2_ORYSJ (Probable 1-deoxy-D-xylulose-5-phosphate synthase 2, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=Os07g0190000 PE=2 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 1.5e-21 Identity = 54/69 (78.26%), Postives = 58/69 (84.06%), Query Frame = 0
BLAST of Bhi11G000768 vs. Swiss-Prot
Match: sp|O22567|DXS1_ORYSJ (1-deoxy-D-xylulose-5-phosphate synthase 1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=CLA1 PE=2 SV=2) HSP 1 Score: 94.0 bits (232), Expect = 7.1e-19 Identity = 50/69 (72.46%), Postives = 56/69 (81.16%), Query Frame = 0
BLAST of Bhi11G000768 vs. Swiss-Prot
Match: sp|Q38854|DXS_ARATH (1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DXS PE=1 SV=2) HSP 1 Score: 93.6 bits (231), Expect = 9.3e-19 Identity = 49/69 (71.01%), Postives = 56/69 (81.16%), Query Frame = 0
BLAST of Bhi11G000768 vs. Swiss-Prot
Match: sp|O78328|DXS_CAPAN (Probable 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic OS=Capsicum annuum OX=4072 GN=TKT2 PE=2 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 4.6e-18 Identity = 48/69 (69.57%), Postives = 55/69 (79.71%), Query Frame = 0
BLAST of Bhi11G000768 vs. Swiss-Prot
Match: sp|Q985Y3|DXS_RHILO (1-deoxy-D-xylulose-5-phosphate synthase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=dxs PE=3 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 1.9e-08 Identity = 30/52 (57.69%), Postives = 34/52 (65.38%), Query Frame = 0
BLAST of Bhi11G000768 vs. TrEMBL
Match: tr|A0A1S3BNQ5|A0A1S3BNQ5_CUCME (probable 1-deoxy-D-xylulose-5-phosphate synthase 2, chloroplastic OS=Cucumis melo OX=3656 GN=LOC103491851 PE=3 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 9.6e-21 Identity = 58/69 (84.06%), Postives = 59/69 (85.51%), Query Frame = 0
BLAST of Bhi11G000768 vs. TrEMBL
Match: tr|A0A0A0L869|A0A0A0L869_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G114510 PE=3 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 9.6e-21 Identity = 58/69 (84.06%), Postives = 59/69 (85.51%), Query Frame = 0
BLAST of Bhi11G000768 vs. TrEMBL
Match: tr|A0A224X4B0|A0A224X4B0_HYPAN (1-D-deoxyxylulose 5-phosphate synthase OS=Hypericum androsaemum OX=140968 PE=3 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 2.4e-19 Identity = 55/69 (79.71%), Postives = 58/69 (84.06%), Query Frame = 0
BLAST of Bhi11G000768 vs. TrEMBL
Match: tr|A0A224XFS8|A0A224XFS8_9ROSI (1-D-deoxyxylulose 5-phosphate synthase OS=Hypericum annulatum OX=708052 PE=3 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 2.4e-19 Identity = 55/69 (79.71%), Postives = 58/69 (84.06%), Query Frame = 0
BLAST of Bhi11G000768 vs. TrEMBL
Match: tr|A0A224XGR2|A0A224XGR2_9ROSI (1-D-deoxyxylulose 5-phosphate synthase OS=Hypericum kalmianum OX=473045 PE=3 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 2.4e-19 Identity = 55/69 (79.71%), Postives = 58/69 (84.06%), Query Frame = 0
BLAST of Bhi11G000768 vs. NCBI nr
Match: XP_004134268.1 (PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, chloroplastic [Cucumis sativus] >KGN56311.1 hypothetical protein Csa_3G114510 [Cucumis sativus]) HSP 1 Score: 107.8 bits (268), Expect = 1.5e-20 Identity = 58/69 (84.06%), Postives = 59/69 (85.51%), Query Frame = 0
BLAST of Bhi11G000768 vs. NCBI nr
Match: XP_008450188.1 (PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, chloroplastic [Cucumis melo] >XP_008450189.1 PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, chloroplastic [Cucumis melo] >XP_016900855.1 PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, chloroplastic [Cucumis melo]) HSP 1 Score: 107.8 bits (268), Expect = 1.5e-20 Identity = 58/69 (84.06%), Postives = 59/69 (85.51%), Query Frame = 0
BLAST of Bhi11G000768 vs. NCBI nr
Match: XP_022136584.1 (probable 1-deoxy-D-xylulose-5-phosphate synthase 2, chloroplastic [Momordica charantia]) HSP 1 Score: 106.7 bits (265), Expect = 3.2e-20 Identity = 57/69 (82.61%), Postives = 59/69 (85.51%), Query Frame = 0
BLAST of Bhi11G000768 vs. NCBI nr
Match: XP_020257260.1 (probable 1-deoxy-D-xylulose-5-phosphate synthase 2, chloroplastic isoform X1 [Asparagus officinalis] >XP_020257261.1 probable 1-deoxy-D-xylulose-5-phosphate synthase 2, chloroplastic isoform X2 [Asparagus officinalis] >ONK75412.1 uncharacterized protein A4U43_C03F16580 [Asparagus officinalis]) HSP 1 Score: 103.2 bits (256), Expect = 3.6e-19 Identity = 55/69 (79.71%), Postives = 58/69 (84.06%), Query Frame = 0
BLAST of Bhi11G000768 vs. NCBI nr
Match: XP_015647944.1 (probable 1-deoxy-D-xylulose-5-phosphate synthase 2, chloroplastic [Oryza sativa Japonica Group] >Q6YU51.1 RecName: Full=Probable 1-deoxy-D-xylulose-5-phosphate synthase 2, chloroplastic; Short=1-deoxyxylulose-5-phosphate synthase; Short=DXP synthase; Short=DXPS; Flags: Precursor >BAC84616.1 putative 1-deoxyxylulose 5-phosphate synthase [Oryza sativa Japonica Group] >BAD31023.1 putative 1-deoxyxylulose 5-phosphate synthase [Oryza sativa Japonica Group] >BAF21000.1 Os07g0190000 [Oryza sativa Japonica Group] >BAG94824.1 unnamed protein product [Oryza sativa Japonica Group] >EEE66718.1 hypothetical protein OsJ_23394 [Oryza sativa Japonica Group] >BAT00410.1 Os07g0190000 [Oryza sativa Japonica Group]) HSP 1 Score: 102.8 bits (255), Expect = 4.7e-19 Identity = 54/69 (78.26%), Postives = 58/69 (84.06%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|