Bhi10G001394 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACAAGCACTTGAGCATTTTGGCAAAGCAACATATTGAGACATGTTTTGTAAAAATTAATGCTGAGAAAAGTCCATTTCTGGCTGAGAAGTTGAAGATCGTTGTTCTTTCAACCCTTGCTCTGATCAAGAATGCAAAAGTAGATGACTATGTGGTATGTCCTTTATGATAATACACTATTGATTACTGAATTATGGTTGTTTTTATTAACATTGCCTTTCTCTCATGTGAATCCATCAGGTAGGATTTGATGAGCTTGGTGGAACTGACGAATTCAACACAGAGGAATTGGAAGATGGATTGGCAAAATGTCAAGTCATCTTCCATCAAGATGAATCATCCATAAATGCTTCAAAATCTAGTGCACAAACCAGGAGAAGTGTACGACAAAATACGAGATCAGACTCATCAAATTCAGAATAA ATGGACAAGCACTTGAGCATTTTGGCAAAGCAACATATTGAGACATGTTTTGTAAAAATTAATGCTGAGAAAAGTCCATTTCTGGCTGAGAAGTTGAAGATCGTTGTTCTTTCAACCCTTGCTCTGATCAAGAATGCAAAAGTAGATGACTATGTGGTAGGATTTGATGAGCTTGGTGGAACTGACGAATTCAACACAGAGGAATTGGAAGATGGATTGGCAAAATGTCAAGTCATCTTCCATCAAGATGAATCATCCATAAATGCTTCAAAATCTAGTGCACAAACCAGGAGAAGTGTACGACAAAATACGAGATCAGACTCATCAAATTCAGAATAA ATGGACAAGCACTTGAGCATTTTGGCAAAGCAACATATTGAGACATGTTTTGTAAAAATTAATGCTGAGAAAAGTCCATTTCTGGCTGAGAAGTTGAAGATCGTTGTTCTTTCAACCCTTGCTCTGATCAAGAATGCAAAAGTAGATGACTATGTGGTAGGATTTGATGAGCTTGGTGGAACTGACGAATTCAACACAGAGGAATTGGAAGATGGATTGGCAAAATGTCAAGTCATCTTCCATCAAGATGAATCATCCATAAATGCTTCAAAATCTAGTGCACAAACCAGGAGAAGTGTACGACAAAATACGAGATCAGACTCATCAAATTCAGAATAA MDKHLSILAKQHIETCFVKINAEKSPFLAEKLKIVVLSTLALIKNAKVDDYVVGFDELGGTDEFNTEELEDGLAKCQVIFHQDESSINASKSSAQTRRSVRQNTRSDSSNSE
BLAST of Bhi10G001394 vs. TAIR10
Match: AT2G18990.1 (thioredoxin domain-containing protein 9 homolog) HSP 1 Score: 144.8 bits (364), Expect = 3.2e-35 Identity = 78/110 (70.91%), Postives = 92/110 (83.64%), Query Frame = 0
BLAST of Bhi10G001394 vs. TAIR10
Match: AT3G25580.1 (Thioredoxin superfamily protein) HSP 1 Score: 144.4 bits (363), Expect = 4.1e-35 Identity = 78/110 (70.91%), Postives = 94/110 (85.45%), Query Frame = 0
BLAST of Bhi10G001394 vs. TAIR10
Match: AT5G66410.1 (phosducin-like protein 3 homolog) HSP 1 Score: 66.2 bits (160), Expect = 1.4e-11 Identity = 43/114 (37.72%), Postives = 63/114 (55.26%), Query Frame = 0
BLAST of Bhi10G001394 vs. TAIR10
Match: AT3G50960.1 (phosducin-like protein 3 homolog) HSP 1 Score: 62.4 bits (150), Expect = 2.1e-10 Identity = 40/111 (36.04%), Postives = 57/111 (51.35%), Query Frame = 0
BLAST of Bhi10G001394 vs. Swiss-Prot
Match: sp|O64628|TXND9_ARATH (Thioredoxin domain-containing protein 9 homolog OS=Arabidopsis thaliana OX=3702 GN=At2g18990 PE=2 SV=1) HSP 1 Score: 144.8 bits (364), Expect = 5.7e-34 Identity = 78/110 (70.91%), Postives = 92/110 (83.64%), Query Frame = 0
BLAST of Bhi10G001394 vs. Swiss-Prot
Match: sp|Q9CQ79|TXND9_MOUSE (Thioredoxin domain-containing protein 9 OS=Mus musculus OX=10090 GN=Txndc9 PE=1 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.3e-17 Identity = 52/118 (44.07%), Postives = 75/118 (63.56%), Query Frame = 0
BLAST of Bhi10G001394 vs. Swiss-Prot
Match: sp|O14530|TXND9_HUMAN (Thioredoxin domain-containing protein 9 OS=Homo sapiens OX=9606 GN=TXNDC9 PE=1 SV=2) HSP 1 Score: 89.4 bits (220), Expect = 2.8e-17 Identity = 50/118 (42.37%), Postives = 74/118 (62.71%), Query Frame = 0
BLAST of Bhi10G001394 vs. Swiss-Prot
Match: sp|Q8K581|TXND9_RAT (Thioredoxin domain-containing protein 9 OS=Rattus norvegicus OX=10116 GN=Txndc9 PE=2 SV=2) HSP 1 Score: 88.2 bits (217), Expect = 6.3e-17 Identity = 51/118 (43.22%), Postives = 74/118 (62.71%), Query Frame = 0
BLAST of Bhi10G001394 vs. Swiss-Prot
Match: sp|O18883|TXND9_BOVIN (Thioredoxin domain-containing protein 9 OS=Bos taurus OX=9913 GN=TXNDC9 PE=2 SV=2) HSP 1 Score: 87.4 bits (215), Expect = 1.1e-16 Identity = 49/118 (41.53%), Postives = 74/118 (62.71%), Query Frame = 0
BLAST of Bhi10G001394 vs. TrEMBL
Match: tr|A0A1S3C206|A0A1S3C206_CUCME (thioredoxin domain-containing protein 9 homolog OS=Cucumis melo OX=3656 GN=LOC103495950 PE=4 SV=1) HSP 1 Score: 189.9 bits (481), Expect = 3.1e-45 Identity = 103/112 (91.96%), Postives = 107/112 (95.54%), Query Frame = 0
BLAST of Bhi10G001394 vs. TrEMBL
Match: tr|A0A0A0LT99|A0A0A0LT99_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G418960 PE=4 SV=1) HSP 1 Score: 189.9 bits (481), Expect = 3.1e-45 Identity = 103/112 (91.96%), Postives = 107/112 (95.54%), Query Frame = 0
BLAST of Bhi10G001394 vs. TrEMBL
Match: tr|A9PC45|A9PC45_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_009G092700v3 PE=2 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 2.0e-39 Identity = 92/112 (82.14%), Postives = 102/112 (91.07%), Query Frame = 0
BLAST of Bhi10G001394 vs. TrEMBL
Match: tr|I1LEH0|I1LEH0_SOYBN (Uncharacterized protein OS=Glycine max OX=3847 GN=100814116 PE=4 SV=1) HSP 1 Score: 169.5 bits (428), Expect = 4.4e-39 Identity = 91/112 (81.25%), Postives = 104/112 (92.86%), Query Frame = 0
BLAST of Bhi10G001394 vs. TrEMBL
Match: tr|A0A2P5EYL3|A0A2P5EYL3_9ROSA (Thioredoxin domain-containing protein OS=Trema orientalis OX=63057 GN=TorRG33x02_136670 PE=4 SV=1) HSP 1 Score: 168.3 bits (425), Expect = 9.7e-39 Identity = 92/112 (82.14%), Postives = 102/112 (91.07%), Query Frame = 0
BLAST of Bhi10G001394 vs. NCBI nr
Match: XP_011650010.1 (PREDICTED: thioredoxin domain-containing protein 9 homolog [Cucumis sativus] >KGN63261.1 hypothetical protein Csa_2G418960 [Cucumis sativus]) HSP 1 Score: 189.9 bits (481), Expect = 4.7e-45 Identity = 103/112 (91.96%), Postives = 107/112 (95.54%), Query Frame = 0
BLAST of Bhi10G001394 vs. NCBI nr
Match: XP_008455854.1 (PREDICTED: thioredoxin domain-containing protein 9 homolog [Cucumis melo] >XP_008455855.1 PREDICTED: thioredoxin domain-containing protein 9 homolog [Cucumis melo]) HSP 1 Score: 189.9 bits (481), Expect = 4.7e-45 Identity = 103/112 (91.96%), Postives = 107/112 (95.54%), Query Frame = 0
BLAST of Bhi10G001394 vs. NCBI nr
Match: XP_022944636.1 (thioredoxin domain-containing protein 9 homolog [Cucurbita moschata] >XP_022944637.1 thioredoxin domain-containing protein 9 homolog [Cucurbita moschata] >XP_022944638.1 thioredoxin domain-containing protein 9 homolog [Cucurbita moschata] >XP_022986377.1 thioredoxin domain-containing protein 9 homolog [Cucurbita maxima] >XP_022986378.1 thioredoxin domain-containing protein 9 homolog [Cucurbita maxima] >XP_022986379.1 thioredoxin domain-containing protein 9 homolog [Cucurbita maxima] >XP_022986380.1 thioredoxin domain-containing protein 9 homolog [Cucurbita maxima] >XP_022986381.1 thioredoxin domain-containing protein 9 homolog [Cucurbita maxima]) HSP 1 Score: 184.9 bits (468), Expect = 1.5e-43 Identity = 100/112 (89.29%), Postives = 107/112 (95.54%), Query Frame = 0
BLAST of Bhi10G001394 vs. NCBI nr
Match: XP_023513333.1 (thioredoxin domain-containing protein 9 homolog [Cucurbita pepo subsp. pepo] >XP_023513334.1 thioredoxin domain-containing protein 9 homolog [Cucurbita pepo subsp. pepo] >XP_023513335.1 thioredoxin domain-containing protein 9 homolog [Cucurbita pepo subsp. pepo]) HSP 1 Score: 184.1 bits (466), Expect = 2.6e-43 Identity = 100/112 (89.29%), Postives = 106/112 (94.64%), Query Frame = 0
BLAST of Bhi10G001394 vs. NCBI nr
Match: XP_022145711.1 (thioredoxin domain-containing protein 9 homolog [Momordica charantia] >XP_022145719.1 thioredoxin domain-containing protein 9 homolog [Momordica charantia] >XP_022145726.1 thioredoxin domain-containing protein 9 homolog [Momordica charantia]) HSP 1 Score: 179.5 bits (454), Expect = 6.4e-42 Identity = 99/112 (88.39%), Postives = 107/112 (95.54%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|