Bhi10G001371 (gene) Wax gourd
The following sequences are available for this feature:
Legend: exonfive_prime_UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.AAAGGTTTCATTAACTTCTAATTCATGTCGAGTAGACCTTGTTGTTGCGAGAATTCTTAATTCATGAGTTGTAGGGAGGGACTTATGTCACCACAAACAGAGACTAAAGCAAGTGTTGGATTCAAAGGTGGTGTTAAAGATTATAAATTGACTTATTATACTCCTGAATATGAAACCAAAGATACTGATATCTTGGGAGCATTCCGAGTAACTCCTCAACCGGGAGTTCCACCTGAGGAAGCAGGGGCCGCTGTAGCTGCTGAATCTTCTACTGGTACATGGACAACTGTGTGGACCGATGGGCTTACTAGTCTTGATCGTCCTTTGTAG AAAGGTTTCATTAACTTCTAATTCATGTCGAGTAGACCTTGTTGTTGCGAGAATTCTTAATTCATGAGTTGTAGGGAGGGACTTATGTCACCACAAACAGAGACTAAAGCAAGTGTTGGATTCAAAGGTGGTGTTAAAGATTATAAATTGACTTATTATACTCCTGAATATGAAACCAAAGATACTGATATCTTGGGAGCATTCCGAGTAACTCCTCAACCGGGAGTTCCACCTGAGGAAGCAGGGGCCGCTGTAGCTGCTGAATCTTCTACTGGTACATGGACAACTGTGTGGACCGATGGGCTTACTAGTCTTGATCGTCCTTTGTAG ATGAGTTGTAGGGAGGGACTTATGTCACCACAAACAGAGACTAAAGCAAGTGTTGGATTCAAAGGTGGTGTTAAAGATTATAAATTGACTTATTATACTCCTGAATATGAAACCAAAGATACTGATATCTTGGGAGCATTCCGAGTAACTCCTCAACCGGGAGTTCCACCTGAGGAAGCAGGGGCCGCTGTAGCTGCTGAATCTTCTACTGGTACATGGACAACTGTGTGGACCGATGGGCTTACTAGTCTTGATCGTCCTTTGTAG MSCREGLMSPQTETKASVGFKGGVKDYKLTYYTPEYETKDTDILGAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRPL
BLAST of Bhi10G001371 vs. TAIR10
Match: ATCG00490.1 (ribulose-bisphosphate carboxylases) HSP 1 Score: 157.5 bits (397), Expect = 3.7e-39 Identity = 76/79 (96.20%), Postives = 77/79 (97.47%), Query Frame = 0
BLAST of Bhi10G001371 vs. Swiss-Prot
Match: sp|P48683|RBL_ANACO (Ribulose bisphosphate carboxylase large chain OS=Ananas comosus OX=4615 GN=rbcL PE=3 SV=1) HSP 1 Score: 159.1 bits (401), Expect = 2.3e-38 Identity = 77/79 (97.47%), Postives = 77/79 (97.47%), Query Frame = 0
BLAST of Bhi10G001371 vs. Swiss-Prot
Match: sp|Q37192|RBL_BARSO (Ribulose bisphosphate carboxylase large chain OS=Bartlettina sordida OX=13517 GN=rbcL PE=3 SV=1) HSP 1 Score: 159.1 bits (401), Expect = 2.3e-38 Identity = 77/79 (97.47%), Postives = 77/79 (97.47%), Query Frame = 0
BLAST of Bhi10G001371 vs. Swiss-Prot
Match: sp|P48693|RBL_CICIN (Ribulose bisphosphate carboxylase large chain OS=Cichorium intybus OX=13427 GN=rbcL PE=3 SV=1) HSP 1 Score: 159.1 bits (401), Expect = 2.3e-38 Identity = 77/79 (97.47%), Postives = 77/79 (97.47%), Query Frame = 0
BLAST of Bhi10G001371 vs. Swiss-Prot
Match: sp|P28392|RBL_CLAXA (Ribulose bisphosphate carboxylase large chain OS=Clarkia xantiana OX=3938 GN=rbcL PE=2 SV=1) HSP 1 Score: 159.1 bits (401), Expect = 2.3e-38 Identity = 77/79 (97.47%), Postives = 77/79 (97.47%), Query Frame = 0
BLAST of Bhi10G001371 vs. Swiss-Prot
Match: sp|P31183|RBL_CORLA (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Corynocarpus laevigatus OX=4312 GN=rbcL PE=3 SV=2) HSP 1 Score: 159.1 bits (401), Expect = 2.3e-38 Identity = 77/79 (97.47%), Postives = 77/79 (97.47%), Query Frame = 0
BLAST of Bhi10G001371 vs. TrEMBL
Match: tr|A0A223A8E8|A0A223A8E8_9ROSA (Ribulose bisphosphate carboxylase large chain OS=Trema orientalis OX=63057 GN=rbcL PE=3 SV=1) HSP 1 Score: 174.1 bits (440), Expect = 1.4e-40 Identity = 84/86 (97.67%), Postives = 84/86 (97.67%), Query Frame = 0
BLAST of Bhi10G001371 vs. TrEMBL
Match: tr|A0A1P8LDI3|A0A1P8LDI3_CITLA (Ribulose bisphosphate carboxylase large chain OS=Citrullus lanatus subsp. vulgaris OX=260674 GN=rbcL PE=3 SV=1) HSP 1 Score: 174.1 bits (440), Expect = 1.4e-40 Identity = 84/86 (97.67%), Postives = 84/86 (97.67%), Query Frame = 0
BLAST of Bhi10G001371 vs. TrEMBL
Match: tr|A0A1P8LE76|A0A1P8LE76_9ROSI (Ribulose bisphosphate carboxylase large chain OS=Citrullus mucosospermus OX=519315 GN=rbcL PE=3 SV=1) HSP 1 Score: 174.1 bits (440), Expect = 1.4e-40 Identity = 84/86 (97.67%), Postives = 84/86 (97.67%), Query Frame = 0
BLAST of Bhi10G001371 vs. TrEMBL
Match: tr|A0A0A8XQ33|A0A0A8XQ33_ARUDO (Ribulose bisphosphate carboxylase large chain OS=Arundo donax OX=35708 GN=rbcL PE=3 SV=1) HSP 1 Score: 174.1 bits (440), Expect = 1.4e-40 Identity = 84/86 (97.67%), Postives = 84/86 (97.67%), Query Frame = 0
BLAST of Bhi10G001371 vs. TrEMBL
Match: tr|A0A0H3VXN4|A0A0H3VXN4_9POAL (Ribulose bisphosphate carboxylase large chain OS=Otatea glauca OX=464970 GN=rbcL PE=3 SV=1) HSP 1 Score: 174.1 bits (440), Expect = 1.4e-40 Identity = 84/86 (97.67%), Postives = 84/86 (97.67%), Query Frame = 0
BLAST of Bhi10G001371 vs. NCBI nr
Match: AFA27693.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (plastid) [Potarophytum riparium]) HSP 1 Score: 174.1 bits (440), Expect = 2.1e-40 Identity = 84/86 (97.67%), Postives = 84/86 (97.67%), Query Frame = 0
BLAST of Bhi10G001371 vs. NCBI nr
Match: YP_007475969.1 (ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit [Bismarckia nobilis] >AGE93034.1 ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit (plastid) [Bismarckia nobilis]) HSP 1 Score: 174.1 bits (440), Expect = 2.1e-40 Identity = 84/86 (97.67%), Postives = 84/86 (97.67%), Query Frame = 0
BLAST of Bhi10G001371 vs. NCBI nr
Match: AXR90619.1 (ribulose bisophosphate carboxylase (chloroplast) [Indosasa sinica] >AXR90705.1 ribulose bisophosphate carboxylase (chloroplast) [Indosasa sinica] >AXR90790.1 ribulose bisophosphate carboxylase (chloroplast) [Indosasa sinica] >AXR90878.1 ribulose bisophosphate carboxylase (chloroplast) [Indosasa sinica]) HSP 1 Score: 174.1 bits (440), Expect = 2.1e-40 Identity = 84/86 (97.67%), Postives = 84/86 (97.67%), Query Frame = 0
BLAST of Bhi10G001371 vs. NCBI nr
Match: AXR94555.1 (ribulose bisophosphate carboxylase (chloroplast) [Hodgsonia macrocarpa] >AXR94641.1 ribulose bisophosphate carboxylase (chloroplast) [Hodgsonia macrocarpa] >AXR94725.1 ribulose bisophosphate carboxylase (chloroplast) [Hodgsonia macrocarpa] >AXR94810.1 ribulose bisophosphate carboxylase (chloroplast) [Hodgsonia macrocarpa]) HSP 1 Score: 174.1 bits (440), Expect = 2.1e-40 Identity = 84/86 (97.67%), Postives = 84/86 (97.67%), Query Frame = 0
BLAST of Bhi10G001371 vs. NCBI nr
Match: YP_009157911.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit (plastid) [Chusquea circinata] >AKH04439.1 ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit (plastid) [Chusquea circinata] >AKH04523.1 ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit (plastid) [Chusquea sp. PFM-2015]) HSP 1 Score: 174.1 bits (440), Expect = 2.1e-40 Identity = 84/86 (97.67%), Postives = 84/86 (97.67%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|